PPPDE1/PNAS4 Polyclonal antibody 20517-1-AP proteintech
$149.00
In stock
SKU
20517-1-AP
| Catalog Number | 20517-1-AP |
| Synonyms | PPPDE1, CGI-146, DESI2, DeSI-2, Desumoylating isopeptidase 2 |
| Host | Rabbit |
| Reactivity | human and More (2) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, NCI-H1299 cells, A549 cells, U-251 cells |
| Tested Applications — Positive IP detected in | A549 cells |
| Tested Applications — Positive IHC detected in | human liver cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:300-1:600 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| Positive WB detected in | HeLa cells, NCI-H1299 cells, A549 cells, U-251 cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human liver cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:300-1:600 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14352 Product name: Recombinant human PPPDE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC004485 Sequence: MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHTKL Predict reactive species |
| Full Name | PPPDE peptidase domain containing 1 |
| Calculated Molecular Weight | 194 aa, 21 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC004485 |
| Gene Symbol | PPPDE1 |
| Gene ID (NCBI) | 51029 |
| RRID | AB_10696177 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BSY9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for PPPDE1/PNAS4 antibody 20517-1-AP | Download protocol |
| IHC protocol for PPPDE1/PNAS4 antibody 20517-1-AP | Download protocol |
| IP protocol for PPPDE1/PNAS4 antibody 20517-1-AP | Download protocol |
| WB protocol for PPPDE1/PNAS4 antibody 20517-1-AP | Download protocol |
| human | WB,IHC Oncol Lett Analysis of transcription profile to reveal altered signaling pathways following the overexpression of human desumoylating isopeptidase 2 in pancreatic cancer cells. Authors - Yu-Yin Fu View Article |
| rat | WB,IHC,IF Exp Cell Res Upregulation of PPPDE1 contributes to anorectal malformations via the mitochondrial apoptosis pathway during hindgut development in rats. Authors - Si Ying Li View Article |
| mouse,human | WB,IHC,IF Biochimie Comprehensive analysis of expression profile reveals the ubiquitous distribution of PPPDE peptidase domain 1, a Golgi apparatus component, and its implications in clinical cancer. Authors - He Yi Y View Article |
| Citations | 7 |
| Dilutions | WB : 1:300-1:600 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:10-1:100 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
PPPDE peptidase domain 1 (PPPDE1), also named as PNAS4, is a highly conserved gene ubiquitously expressed in various tissues. PPPDE1 has been identified as a novel pro-apoptotic gene activated during the early response to DNA damage which is thought to play a critical role in cellular function regarding the maintenance of genomic integrity. This antibody specifically recognized endogenous PPPDE1, which has been confirmed by siRNA test. Protocols Product Specific Protocols IF protocol for PPPDE1/PNAS4 antibody 20517-1-AP Download protocol IHC protocol for PPPDE1/PNAS4 antibody 20517-1-AP Download protocol IP protocol for PPPDE1/PNAS4 antibody 20517-1-AP Download protocol WB protocol for PPPDE1/PNAS4 antibody 20517-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- PPPDE1 promotes hepatocellular carcinoma development by negatively regulate p53 and apoptosis.
Journal: Apoptosis | Authors: Xingwang Xie | Species: human | Application: WB - Upregulation of PPPDE1 contributes to anorectal malformations via the mitochondrial apoptosis pathway during hindgut development in rats.
Journal: Exp Cell Res | Authors: Si Ying Li | Species: rat | Application: WB,IHC,IF - Comprehensive analysis of expression profile reveals the ubiquitous distribution of PPPDE peptidase domain 1, a Golgi apparatus component, and its implications in clinical cancer.
Journal: Biochimie | Authors: He Yi Y | Species: mouse,human | Application: WB,IHC,IF - PPPDE1 is a novel deubiquitinase belonging to a cysteine isopeptidase family.
Journal: Biochem Biophys Res Commun | Authors: Xingwang Xie | Species: human | Application: WB - High Phosphorylation Status of AKT/mTOR Signal in DESI2-Reduced Pancreatic Ductal Adenocarcinoma.
Journal: Pathol Oncol Res | Authors: Cong-Cong Shen | Species: human | Application: WB,IHC - Analysis of transcription profile to reveal altered signaling pathways following the overexpression of human desumoylating isopeptidase 2 in pancreatic cancer cells.
Journal: Oncol Lett | Authors: Yu-Yin Fu | Species: human | Application: WB,IHC - Analysis of transcription profile to reveal altered signaling pathways following the overexpression of human desumoylating isopeptidase 2 in pancreatic cancer cells.
Journal: Oncol Lett | Authors: Yu-Yin Fu | Species: human | Application: WB,IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
