Pancreatic Polypeptide Polyclonal antibody 15493-1-AP proteintech
$149.00
In stock
SKU
15493-1-AP
| Catalog Number | 15493-1-AP |
| Synonyms | PPY, Obinepitide, Pancreatic icosapeptide, Pancreatic polypeptide prohormone, Pancreatic polypeptide Y |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, IF-P, FC (Intra), ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | rat pancreas tissue |
| Tested Applications — Positive FC (Intra) detected in | HepG2 cells |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive IHC detected in | mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat pancreas tissue |
| Positive FC (Intra) detected in | HepG2 cells |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag7886 Product name: Recombinant human PPY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC032225 Sequence: MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL Predict reactive species |
| Full Name | pancreatic polypeptide |
| Calculated Molecular Weight | 10 kDa |
| GenBank Accession Number | BC032225 |
| Gene Symbol | Pancreatic Polypeptide |
| Gene ID (NCBI) | 5539 |
| RRID | AB_2878145 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01298 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for Pancreatic Polypeptide antibody 15493-1-AP | Download protocol |
| IF protocol for Pancreatic Polypeptide antibody 15493-1-AP | Download protocol |
| IHC protocol for Pancreatic Polypeptide antibody 15493-1-AP | Download protocol |
| mouse,human | IF Adv Sci (Weinh) PPY-Induced iCAFs Cultivate an Immunosuppressive Microenvironment in Pancreatic Cancer Authors - Mengdie Cao View Article |
| mouse | IHC Transpl Int Formation of Re-Aggregated Neonatal Porcine Islet Clusters Improves In Vitro Function and Transplantation Outcome Authors - M Honarpisheh View Article |
| Citations | 7 |
| Dilutions | IHC : 1:1000-1:4000 IF-P : 1:50-1:500 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- PPY-Induced iCAFs Cultivate an Immunosuppressive Microenvironment in Pancreatic Cancer
Journal: Adv Sci (Weinh) | Authors: Mengdie Cao | Species: mouse,human | Application: IF - A sulfated manno-glucuronan ameliorates β-cell dysfunction in type 2 diabetes by targeting ALDH1A3.
Journal: Carbohydr Polym | Authors: Wenjing Zhang | Species: mouse | Application: IHC,IF - Mettl3-Mediated m6A Methylation Controls Pancreatic Bipotent Progenitor Fate and Islet Formation
Journal: Diabetes | Authors: Jiajun Sun | Species: mouse | Application: IF - A ONECUT1 regulatory, non-coding region in pancreatic development and diabetes
Journal: Cell Rep | Authors: Sarah Merz - Lighting up PNETs: Creating Murine Models with a Novel Bioluminescent Cell Line.
Journal: Ann Surg Oncol | Authors: Matthew C. Moccia | Species: mouse | Application: IHC - Formation of Re-Aggregated Neonatal Porcine Islet Clusters Improves In Vitro Function and Transplantation Outcome
Journal: Transpl Int | Authors: M Honarpisheh | Species: mouse | Application: IHC - Histology and immunofluorescent study of the pancreas in lovebird (Agapornis personatus)
Journal: Vet Med Sci | Authors: Nader Goodarzi | Application: IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
