PPYR1 Polyclonal antibody 21654-1-AP proteintech
$149.00
In stock
SKU
21654-1-AP
| Catalog Number | 21654-1-AP |
| Synonyms | Neuropeptide Y receptor type 4, PP1, PPYR1, Y4 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive IHC detected in | human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag16374 Product name: Recombinant human PPYR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 317-375 aa of BC096238 Sequence: VNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSLRLSGRSNPI Predict reactive species |
| Full Name | pancreatic polypeptide receptor 1 |
| Calculated Molecular Weight | 375 aa, 42 kDa |
| GenBank Accession Number | BC096238 |
| Gene Symbol | PPYR1 |
| Gene ID (NCBI) | 5540 |
| RRID | AB_2878900 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P50391 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for PPYR1 antibody 21654-1-AP | Download protocol |
| Citations | - |
| Dilutions | IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
PPYR1 (pancreatic polypeptide receptor 1), also known as NPY4R, is a member of the G-protein coupled receptor 1 family. PPYR1 is a receptor for the PP-fold peptides (pancreatic polypeptide, peptide YY, and neuropeptide Y) and pancreatic polypeptide is the preferred ligand (PMID: 12626767). It may be regulating central nervous system, cardiovascular and gastrointestinal function. It has been reported that PPYR1 gene is a key regulator of energy homeostasis (PMID: 12000791). PPYR1 gene copy number gain has been associated with lower body mass index (BMI) (PMID: 19229253). Protocols Product Specific Protocols IHC protocol for PPYR1 antibody 21654-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
