PRLHR Polyclonal antibody 24800-1-AP proteintech
$149.00
In stock
SKU
24800-1-AP
| Catalog Number | 24800-1-AP |
| Synonyms | PrRPR, PrRP receptor, hGR3, GR3, GPR10 |
| Host | Rabbit |
| Reactivity | human, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HepG2 cells, Jurkat cells, SH-SY5Y cells, rat brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Positive WB detected in | HepG2 cells, Jurkat cells, SH-SY5Y cells, rat brain tissue |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Tested Reactivity | human, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag20098 Product name: Recombinant human PRLHR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC101490 Sequence: MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVV Predict reactive species |
| Full Name | prolactin releasing hormone receptor |
| Calculated Molecular Weight | 370 aa, 41 kDa |
| Observed Molecular Weight | 41 kDa |
| GenBank Accession Number | BC101490 |
| Gene Symbol | PRLHR |
| Gene ID (NCBI) | 2834 |
| RRID | AB_3669450 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49683 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for PRLHR antibody 24800-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:1000-1:4000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
PRLHR (prolactin-releasing hormone receptor) is implicated in lactation, regulation of food intake, and pain-signal processing. Protocols Product Specific Protocols WB protocol for PRLHR antibody 24800-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
