Prokineticin 2 Polyclonal antibody 24906-1-AP proteintech
$149.00
In stock
SKU
24906-1-AP
| Catalog Number | 24906-1-AP |
| Synonyms | BV8, KAL4, MIT1, PK2, PROK2, prokineticin 2, Protein Bv8 homolog |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human colon tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Positive IHC detected in | human colon tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag20622 Product name: Recombinant human PROK2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 32-106 aa of BC098162 Sequence: GACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHT Predict reactive species |
| Full Name | prokineticin 2 |
| Calculated Molecular Weight | 129 aa, 14 kDa |
| GenBank Accession Number | BC098162 |
| Gene Symbol | Prokineticin 2 |
| Gene ID (NCBI) | 60675 |
| RRID | AB_2879792 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9HC23 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Prokineticin 2 antibody 24906-1-AP | Download protocol |
| Citations | - |
| Dilutions | IHC : 1:20-1:200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
