PSMB10 Polyclonal antibody 15976-1-AP proteintech
$149.00
In stock
SKU
15976-1-AP
| Catalog Number | 15976-1-AP |
| Synonyms | beta2i, LMP10, Low molecular mass protein 10, Macropain subunit MECl 1, MECL1, Proteasome MECl 1, Proteasome subunit beta 2i, PSMB10 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Raji cells, human liver tissue |
| Tested Applications — Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | Raji cells, human liver tissue |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag8764 Product name: Recombinant human PSMB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC017198 Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE Predict reactive species |
| Full Name | proteasome (prosome, macropain) subunit, beta type, 10 |
| Calculated Molecular Weight | 273 aa, 29 kDa |
| Observed Molecular Weight | 29 kDa |
| GenBank Accession Number | BC017198 |
| Gene Symbol | PSMB10 |
| Gene ID (NCBI) | 5699 |
| RRID | AB_2171872 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P40306 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for PSMB10 antibody 15976-1-AP | Download protocol |
| IHC protocol for PSMB10 antibody 15976-1-AP | Download protocol |
| WB protocol for PSMB10 antibody 15976-1-AP | Download protocol |
| human | WB Int J Mol Sci Gemcitabine Modulates HLA-I Regulation to Improve Tumor Antigen Presentation by Pancreatic Cancer Cells Authors - Alaina C Larson View Article |
| Citations | 7 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The proteasome subunit, beta type 10 (PSMB10) gene regulated by interferon-gamma is a core part of the 26S proteasome complex, which is an important protein degrading system. Study identifies immunosubunit PSMB10 as a novel regulator that contributes to Ang II-induced atrial fibrillation (AF) and suggests that inhibition of PSMB10 may represent a potential therapeutic target for treating hypertensive AF. (PMID: 29507100, PMID: 16965406) Protocols Product Specific Protocols IF protocol for PSMB10 antibody 15976-1-AP Download protocol IHC protocol for PSMB10 antibody 15976-1-AP Download protocol WB protocol for PSMB10 antibody 15976-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- ECM29/proteasome-mediated self-antigen generation by CNS-resident neuroglia promotes regulatory T cell activation
Journal: Cell Rep | Authors: Sheng-Wen Chen - Selective Inhibition of the Immunoproteasome β5i Prevents PTEN Degradation and Attenuates Cardiac Hypertrophy.
Journal: Front Pharmacol | Authors: Xin Xie | Application: WB - Molecular alteration of the proteasome contributes to AD-like pathology in the brain of HFD-STZ diabetic rats
Journal: Metab Brain Dis | Authors: Han Gao | Application: WB - Melatonin inhibits angiotensin II-induced atrial fibrillation through preventing degradation of Ang II Type I Receptor-Associated Protein (ATRAP)
Journal: Biochem Pharmacol | Authors: Xin Xie | Application: WB - Immunoproteasome subunits are novel signatures for predicting efficacy of immunotherapy in muscle invasive bladder cancer
Journal: J Transl Med | Authors: XinJian Wang | Species: human | Application: IHC - Gemcitabine Modulates HLA-I Regulation to Improve Tumor Antigen Presentation by Pancreatic Cancer Cells
Journal: Int J Mol Sci | Authors: Alaina C Larson | Species: human | Application: WB - Molecular alteration of the proteasome contributes to AD-like pathology in the brain of HFD-STZ diabetic rats
Journal: Metab Brain Dis | Authors: Han Gao | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
