PTGR1 Polyclonal antibody 13374-1-AP proteintech
$149.00
In stock
SKU
13374-1-AP
| Catalog Number | 13374-1-AP |
| Synonyms | LTB4DH, PGR1, PRG 1, prostaglandin reductase 1, PTGR1, ZADH3 |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, human colon tissue, human liver tissue, mouse liver tissue, HepG2 cells, rar liver tissue |
| Tested Applications — Positive IP detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Positive WB detected in | HeLa cells, human colon tissue, human liver tissue, mouse liver tissue, HepG2 cells, rar liver tissue |
| Positive IP detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag4196 Product name: Recombinant human PTGR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-329 aa of BC035228 Sequence: MVRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA Predict reactive species |
| Full Name | prostaglandin reductase 1 |
| Calculated Molecular Weight | 329 aa, 36 kDa |
| Observed Molecular Weight | 36 kDa |
| GenBank Accession Number | BC035228 |
| Gene Symbol | PTGR1 |
| Gene ID (NCBI) | 22949 |
| RRID | AB_2173213 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14914 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IP protocol for PTGR1 antibody 13374-1-AP | Download protocol |
| WB protocol for PTGR1 antibody 13374-1-AP | Download protocol |
| human | WB Mol Cancer Ther Conditional Dependency of LP-184 on Prostaglandin Reductase 1 is Synthetic Lethal in Pancreatic Cancers with DNA Damage Repair Deficiencies Authors - Diana Restifo View Article |
| Kristen (Verified Customer) (12-15-2025) | Used as positive control (known to be expressed in HeLa cells), no background/non-specific bands seen Applications: Western Blot Cell Tissue Type: HeLa |
| Casey (Verified Customer) (12-02-2025) | This antibody worked really well. Band was validated with siPTGR1 Knockdowns. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: melanoma cells |
| Haley (Verified Customer) (11-25-2025) | Highly recommended Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Cancer cells |
| Jelan (Verified Customer) (10-31-2025) | We use this antibody for completing our western blots, and we are a big lab who do westerns alot and we have not had any issues with this specific protein and it seems to be blotting fine. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Rabbit / IgG |
| Diana (Verified Customer) (10-17-2025) | Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: melanoma |
| Citations | 3 |
| Dilutions | WB : 1:1000-1:6000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
PTGR1(Prostaglandin reductase 1) is also named as LTB4DH(NADP-dependent leukotriene B4 12-hydroxydehydrogenase) and belongs to the NADP-dependent oxidoreductase L4BD family. It catalyses the conversion of leukotriene B4 into biologically less reactive 12-oxo-leukotriene B4, a key step for its inactivation and it is a key oxidation step in the process of metabolic inactivation of leukotriene B(4) in various non-leukocyte tissues(PMID:8576264). Protocols Product Specific Protocols IP protocol for PTGR1 antibody 13374-1-AP Download protocol WB protocol for PTGR1 antibody 13374-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Modulation of Nitro-Fatty Acid Signaling: Prostaglandin Reductase-1 is a Nitroalkene Reductase.
Journal: J Biol Chem | Authors: Vitturi Dario A DA | Species: human | Application: WB - NUCB2 promotes hepatocellular carcinoma cell growth and metastasis by activating the E2F4/PTGR1 axis
Journal: Int J Biol Sci | Authors: Yuan Wang | Species: human | Application: WB - Conditional Dependency of LP-184 on Prostaglandin Reductase 1 is Synthetic Lethal in Pancreatic Cancers with DNA Damage Repair Deficiencies
Journal: Mol Cancer Ther | Authors: Diana Restifo | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
