| Catalog Number | 83224-5-RR |
| Synonyms | PARK2, Parkin, E3 ubiquitin-protein ligase parkin, EC:2.3.2.31, Parkin RBR E3 ubiquitin-protein ligase |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293T cells, SH-SY5Y cells, Neuro-2a cells, mouse brain tissue |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
| Positive WB detected in | HEK-293T cells, SH-SY5Y cells, Neuro-2a cells, mouse brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:500-1:2000 |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag5092 Product name: Recombinant human Parkin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 81-387 aa of BC022014 Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK Predict reactive species |
| Full Name | Parkinson disease (autosomal recessive, juvenile) 2, parkin |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | BC022014 |
| Gene Symbol | Parkin |
| Gene ID (NCBI) | 5071 |
| RRID | AB_3743470 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O60260 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for PARK2/Parkin antibody 83224-5-RR | Download protocol |
| IHC protocol for PARK2/Parkin antibody 83224-5-RR | Download protocol |
| IP protocol for PARK2/Parkin antibody 83224-5-RR | Download protocol |
| WB protocol for PARK2/Parkin antibody 83224-5-RR | Download protocol |
| SHUNBIN (Verified Customer) (06-29-2026) | Great for immunoblotting. 1:2000, 5% milk block, 1.5 h primary ab incubation. Produced a single specific band for endogenous Parkin in T cell lines. Applications: Western Blot Primary Antibody Dilution: 1:2000 PARK2/Parkin Antibody Western Blot validation (1:2000 dilution) in (Cat no:83224-5-RR) |
| Citations | - |
| Dilutions | WB : 1:2000-1:10000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:200-1:800 IF-P : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 252526H5 |
| Conjugation | Unconjugated |
Parkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a variety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease. Protocols Product Specific Protocols IF protocol for PARK2/Parkin antibody 83224-5-RR Download protocol IHC protocol for PARK2/Parkin antibody 83224-5-RR Download protocol IP protocol for PARK2/Parkin antibody 83224-5-RR Download protocol WB protocol for PARK2/Parkin antibody 83224-5-RR Download protocol Standard Protocols Click here to view our Standard Protocols