Parvalbumin Recombinant monoclonal antibody 85819-4-RR proteintech
$149.00
In stock
SKU
85819-4-RR
| Catalog Number | 85819-4-RR |
| Synonyms | PVALB, Parvalbumin alpha |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse cerebellum tissue |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue |
| Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag30189 Product name: Recombinant human PVALB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-110 aa of NM_002854 Sequence: SMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES Predict reactive species |
| Full Name | parvalbumin |
| Calculated Molecular Weight | 12 kDa |
| GenBank Accession Number | NM_002854 |
| Gene Symbol | Parvalbumin |
| Gene ID (NCBI) | 5816 |
| RRID | AB_3744399 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P20472 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Parvalbumin antibody 85819-4-RR | Download protocol |
| IHC protocol for Parvalbumin antibody 85819-4-RR | Download protocol |
| Iván (Verified Customer) (08-28-2026) | The antibody works well. Applications: Immunohistochemistry, Immunofluorescence Cell Tissue Type: Brain tissue |
| Citations | - |
| Dilutions | IHC : 1:4000-1:16000 IF-P : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250158B6 |
| Conjugation | Unconjugated |
PVALB is a high affinity calcium ion-binding protein that is structurally and functionally similar to calmodulin and troponin C. PVALB is expressed in high levels only in fast-contracting muscles and at lower levels in brain and several endocrine tissues. It is thought to be involved in muscle relaxation. Monomeric (12 kDa) and dimeric (24 kDa) forms, as well as trimeric Parvalbumin (38 kDa), have been described in a literature (PMID: 19616851). Protocols Product Specific Protocols IF protocol for Parvalbumin antibody 85819-4-RR Download protocol IHC protocol for Parvalbumin antibody 85819-4-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
