ADH1C Polyclonal antibody 30621-1-AP proteintech
$149.00
In stock
SKU
30621-1-AP
| Catalog Number | 30621-1-AP |
| Synonyms | ADH1C, Alcohol dehydrogenase 1C |
| Host | Rabbit |
| Reactivity | mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse testis tissue, mouse colon tissue, rat colon tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Positive WB detected in | mouse testis tissue, mouse colon tissue, rat colon tissue |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Tested Reactivity | mouse, rat |
| Cited Reactivity | rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag33037 Product name: Recombinant human ADH1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-374 aa of BC062476 Sequence: ECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGQLDTMMASLLCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNVLPFEKINEGFDLLRSGKSIRTVLT Predict reactive species |
| Full Name | alcohol dehydrogenase 1C (class I), gamma polypeptide |
| Calculated Molecular Weight | 375 aa, 40 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC062476 |
| Gene Symbol | ADH1C |
| Gene ID (NCBI) | 126 |
| RRID | AB_3086375 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P00326 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for ADH1C antibody 30621-1-AP | Download protocol |
| rat | WB Pharmaceuticals (Basel) Shenqi Granules Enhance Recovery from Myocardial Ischemia-Reperfusion Injury by Downregulating MMP9 and ADH1C. Authors - Hai-Xin Liu View Article |
| Citations | 1 |
| Dilutions | WB : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Alcohol dehydrogenase 1C(ADH1C), also known as ADH3, is an alcohol dehydrogenase that can catalyze ethanol oxidation to metabolite acetaldehyde. According to THE HUMAN PROTEIN ATLAS database, ADH1C locates mainly to the cytosol and plasma membrane. Genetic polymorphism of the ADH1C gene (ADH1C*1 allele) is associated with various human cancers, such as gastric cancer, oral cancer and CRC, for it encodes an alcohol dehydrogenase producing 2.5 times more acetaldehyde.(PMID: 35300114) Protocols Product Specific Protocols WB protocol for ADH1C antibody 30621-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Shenqi Granules Enhance Recovery from Myocardial Ischemia-Reperfusion Injury by Downregulating MMP9 and ADH1C.
Journal: Pharmaceuticals (Basel) | Authors: Hai-Xin Liu | Species: rat | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
