RABEP2 Polyclonal antibody 14625-1-AP proteintech
$149.00
In stock
SKU
14625-1-AP
| Catalog Number | 14625-1-AP |
| Synonyms | FRA, Rab GTPase-binding effector protein 2, Rabaptin-5beta, RABEP 2, RABPT5B |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HepG2 cells, mouse liver tissue, Jurkat cells, L02 cells, PC-3 cells |
| Tested Applications — Positive IP detected in | mouse liver tissue |
| Tested Applications — Positive IHC detected in | human cervical cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | MCF-7 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HepG2 cells, mouse liver tissue, Jurkat cells, L02 cells, PC-3 cells |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human cervical cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag6197 Product name: Recombinant human RABEP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-299 aa of BC058900 Sequence: MAAAAPVAADDDERRRRPGAALEDSRSQEGANGEAESGELSRLRAELAGALAEMETMKAVAEVSESTKAEAVAAVQRQCQEEVASLQAILKDSISSYEAQITALKQERQQQQQDCEEKERELGRLKQLLSRAYPLDSLEKQMEKAHEDSEKLREIVLPMEKEIEELKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPLEELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPEQEETASLVSTGTLVPEGIYLPPPGYQLVPDTQWEQLQTEM Predict reactive species |
| Full Name | rabaptin, RAB GTPase binding effector protein 2 |
| Calculated Molecular Weight | 64 kDa |
| Observed Molecular Weight | 59-62 kDa |
| GenBank Accession Number | BC058900 |
| Gene Symbol | RABEP2 |
| Gene ID (NCBI) | 79874 |
| RRID | AB_2175655 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H5N1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for RABEP2 antibody 14625-1-AP | Download protocol |
| IHC protocol for RABEP2 antibody 14625-1-AP | Download protocol |
| IP protocol for RABEP2 antibody 14625-1-AP | Download protocol |
| WB protocol for RABEP2 antibody 14625-1-AP | Download protocol |
| mouse | WB,IF Arterioscler Thromb Vasc Biol Hypoxia-Preconditioned Bone Marrow Mesenchymal Stem Cells Improved Cerebral Collateral Circulation and Stroke Outcome in Mice Authors - Hao Tian View Article |
| human | WB,IF Sci Rep Rab-GTPase binding effector protein 2 (RABEP2) is a primed substrate for Glycogen Synthase kinase-3 (GSK3). Authors - Lisa Logie View Article |
| Sammy (Verified Customer) (04-22-2024) | Excellent antibody for detection of RABEP2 by WB or IF. Applications: Western Blot, Immunofluorescence Primary Antibody Dilution: 1 in 1000 WB and 1 in 200 IF Cell Tissue Type: HUVEC |
| Citations | 7 |
| Dilutions | WB : 1:1000-1:8000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:400-1:1600 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
RABEP2, also named as RABPT5B, plays a role in membrane trafficking and in homotypic early endosome fusion. It has two isoforms with MW 59-63 kDa. Protocols Product Specific Protocols IF protocol for RABEP2 antibody 14625-1-AP Download protocol IHC protocol for RABEP2 antibody 14625-1-AP Download protocol IP protocol for RABEP2 antibody 14625-1-AP Download protocol WB protocol for RABEP2 antibody 14625-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- LncRNAs H19 and HULC, activated by oxidative stress, promote cell migration and invasion in cholangiocarcinoma through a ceRNA manner.
Journal: J Hematol Oncol | Authors: Wen-Tao Wang | Species: mouse | Application: WB - Variants of Rab GTPase-Effector Binding Protein-2 Cause Variation in the Collateral Circulation and Severity of Stroke.
Journal: Stroke | Authors: Jennifer L Lucitti | Species: mouse | Application: WB - Hypoxia-Preconditioned Bone Marrow Mesenchymal Stem Cells Improved Cerebral Collateral Circulation and Stroke Outcome in Mice
Journal: Arterioscler Thromb Vasc Biol | Authors: Hao Tian | Species: mouse | Application: WB,IF - A cross-species approach using an in vivo evaluation platform in mice demonstrates that sequence variation in human RABEP2 modulates ischemic stroke outcomes
Journal: Am J Hum Genet | Authors: Han Kyu Lee | Species: human | Application: WB - 5'-tRF-19-Q1Q89PJZ Suppresses the Proliferation and Metastasis of Pancreatic Cancer Cells via Regulating Hexokinase 1-Mediated Glycolysis
Journal: Biomolecules | Authors: Wenpeng Cao | Species: human | Application: WB - Rab-GTPase binding effector protein 2 (RABEP2) is a primed substrate for Glycogen Synthase kinase-3 (GSK3).
Journal: Sci Rep | Authors: Lisa Logie | Species: human | Application: WB,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
