RANBP9 Polyclonal antibody 17755-1-AP proteintech
$149.00
In stock
SKU
17755-1-AP
| Catalog Number | 17755-1-AP |
| Synonyms | RanBP7, Ran-binding protein M, Ran-binding protein 9, BPM-L, BPM90 |
| Host | Rabbit |
| Reactivity | human, mouse, rat, canine |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, HeLa cells, mouse testis |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | human testis tissue, human skin tissue, mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | mouse brain tissue, HeLa cells, mouse testis |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human testis tissue, human skin tissue, mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag12112 Product name: Recombinant human RANBP9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-389 aa of BC063849 Sequence: MREWRTKIQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRDCGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGIGSCAFATVEDYLH Predict reactive species |
| Full Name | RAN binding protein 9 |
| Calculated Molecular Weight | 388aa,43 kDa; 729aa,78 kDa |
| Observed Molecular Weight | 80-90 kDa |
| GenBank Accession Number | BC063849 |
| Gene Symbol | RANBP9 |
| Gene ID (NCBI) | 10048 |
| RRID | AB_2176803 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96S59 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for RANBP9 antibody 17755-1-AP | Download protocol |
| IHC protocol for RANBP9 antibody 17755-1-AP | Download protocol |
| IP protocol for RANBP9 antibody 17755-1-AP | Download protocol |
| WB protocol for RANBP9 antibody 17755-1-AP | Download protocol |
| human | IHC Transl Cancer Res Reduced RANBP9 expression is associated with poor prognosis in colorectal cancer patients. Authors - Guangbin Wu View Article |
| rat | IF Acta Histochem MicroRNA-26a-5p alleviates neuronal apoptosis and brain injury in intracerebral hemorrhage by targeting RAN binding protein 9. Authors - Huiyuan Zhang View Article |
| mouse | WB Nat Commun Genome-wide screen of Mycobacterium tuberculosis-infected macrophages revealed GID/CTLH complex-mediated modulation of bacterial growth Authors - Nelson V Simwela View Article |
| Lukas (Verified Customer) (08-07-2026) | WB with Blocking in 5% Milk for 1h, 1:1000 primary and 1:10000 secondary AB Anti-Rabbit, there are 3 Bands of which the middle one is the strongest. This one also fits to the expected kDa. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: immortalized brown adipocytes RANBP9 Antibody Western Blot validation (1:1000 dilution) in immortalized brown adipocytes (Cat no:17755-1-AP) |
| Citations | 5 |
| Dilutions | WB : 1:1000-1:4000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- B Cell Receptor-Responsive miR-141 Enhances Epstein-Barr Virus Lytic Cycle via FOXO3 Inhibition.
Journal: mSphere | Authors: Yan Chen | Species: human | Application: WB - RANBP9 suppresses tumor proliferation in colorectal cancer.
Journal: Oncol Lett | Authors: Chunzhi Qin | Species: human | Application: WB - MicroRNA-26a-5p alleviates neuronal apoptosis and brain injury in intracerebral hemorrhage by targeting RAN binding protein 9.
Journal: Acta Histochem | Authors: Huiyuan Zhang | Species: rat | Application: IF - Reduced RANBP9 expression is associated with poor prognosis in colorectal cancer patients.
Journal: Transl Cancer Res | Authors: Guangbin Wu | Species: human | Application: IHC - Genome-wide screen of Mycobacterium tuberculosis-infected macrophages revealed GID/CTLH complex-mediated modulation of bacterial growth
Journal: Nat Commun | Authors: Nelson V Simwela | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
