RBBP6 Recombinant monoclonal antibody, PBS Only (Capture) 85884-4-PBS proteintech
$699.00
In stock
SKU
85884-4-PBS
| Catalog Number | 85884-4-PBS |
| Synonyms | E3 ubiquitin-protein ligase RBBP6, EC:2.3.2.27, MY038, P2P R, P2PR |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag2484 Product name: Recombinant human RBBP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC029352 Sequence: MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL Predict reactive species |
| Full Name | retinoblastoma binding protein 6 |
| Calculated Molecular Weight | 1792 aa, 200 kDa |
| GenBank Accession Number | BC029352 |
| Gene Symbol | RBBP6 |
| Gene ID (NCBI) | 5930 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q7Z6E9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 250142E4 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
