RBM39 Monoclonal antibody 67420-1-Ig proteintech
$149.00
In stock
SKU
67420-1-Ig
| Catalog Number | 67420-1-Ig |
| Synonyms | 2D2C8, CAPER, CAPERalpha, CC1.3, fSAP59 |
| Host | Mouse |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG2b |
| Tested Applications — Positive WB detected in | Caco-2 cells, HEK-293 cells, HeLa cells, LNCaP cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, Neuro-2a cells |
| Tested Applications — Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | Caco-2 cells, HEK-293 cells, HeLa cells, LNCaP cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, Neuro-2a cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag15766 Product name: Recombinant human RBM39 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 328-530 aa of BC141835 Sequence: ERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR Predict reactive species |
| Full Name | RNA binding motif protein 39 |
| Calculated Molecular Weight | 530 aa, 59 kDa |
| Observed Molecular Weight | 60-66 kDa |
| GenBank Accession Number | BC141835 |
| Gene Symbol | RBM39 |
| Gene ID (NCBI) | 9584 |
| RRID | AB_2882660 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q14498 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for RBM39 antibody 67420-1-Ig | Download protocol |
| IHC protocol for RBM39 antibody 67420-1-Ig | Download protocol |
| WB protocol for RBM39 antibody 67420-1-Ig | Download protocol |
| human | WB Cancers (Basel) RBM39 Contributes to MGMT Maintenance in Response to Temozolomide-Induced DNA Damage. Authors - Vahid Khalaj KD Validated View Article |
| mouse,human | WB Cell Rep Exploiting the polypharmacology of alectinib for synergistic RNA splicing disruption with RBM39 degraders. Authors - Yurui Ma View Article |
| Citations | 5 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:150-1:600 IF/ICC : 1:200-1:800 |
| Isotype | IgG2b |
| Clonality | Monoclonal |
| Clone Number | 2D2C8 |
| Conjugation | Unconjugated |
RBM39, also named as HCC1 or RNPC2, is a 530 amino acid protein, which contains three RRM (RNA recognition motif) domains and belongs to the splicing factor SR family. RBM39 is widely expressed in various tissues and with highly expression in pancreas, skeletal muscle, lung and brain. RBM39 is a transcriptional coactivator for steroid nuclear receptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1. RBM39 may be involved in pre-mRNA splicing process. Protocols Product Specific Protocols IF protocol for RBM39 antibody 67420-1-Ig Download protocol IHC protocol for RBM39 antibody 67420-1-Ig Download protocol WB protocol for RBM39 antibody 67420-1-Ig Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- PERK orchestrates an endoplasmic reticulum stress alternative splicing program via CLK1/SRSF1.
Journal: Nat Commun | Authors: Céline Philippe - Spliceosome induction is a druggable dependency of RAS-driven senescence and cancer.
Journal: Nat Commun | Authors: Verena Wagner | Species: human | Application: IHC,IF - Exploiting the polypharmacology of alectinib for synergistic RNA splicing disruption with RBM39 degraders.
Journal: Cell Rep | Authors: Yurui Ma | Species: mouse,human | Application: WB - RBM39 Contributes to MGMT Maintenance in Response to Temozolomide-Induced DNA Damage.
Journal: Cancers (Basel) | Authors: Vahid Khalaj KD Validated | Species: human | Application: WB - RBM39 modulates UPR signaling through alternative splicing of IRE1α/ERN1.
Journal: Genes Dev | Authors: Jeongjin J. Kim
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
