RBM7 Polyclonal antibody 21896-1-AP proteintech
$149.00
In stock
SKU
21896-1-AP
| Catalog Number | 21896-1-AP |
| Synonyms | RNA-binding protein 7, RNA-binding motif protein 7, RNA binding protein 7, RNA binding motif protein 7 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HepG2 cells, HeLa cells |
| Tested Applications — Positive IHC detected in | human liver cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| Positive WB detected in | HepG2 cells, HeLa cells |
| Positive IHC detected in | human liver cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:300-1:1200 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag11106 Product name: Recombinant human RBM7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 5-266 aa of BC034381 Sequence: AAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERTMDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHSFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDDWSHDYDNRRDSSRDGKWRSSRH Predict reactive species |
| Full Name | RNA binding motif protein 7 |
| Calculated Molecular Weight | 266 aa, 31 kDa |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC034381 |
| Gene Symbol | RBM7 |
| Gene ID (NCBI) | 10179 |
| RRID | AB_2878938 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y580 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for RBM7 antibody 21896-1-AP | Download protocol |
| IHC protocol for RBM7 antibody 21896-1-AP | Download protocol |
| WB protocol for RBM7 antibody 21896-1-AP | Download protocol |
| human | WB Mol Genet Genomics RBM7 suppresses mitochondrial dysfunction and ferroptosis by destabilizing FBXL16 mRNA to enhance Temozolomide resistance in glioblastoma. Authors - Nan Liu View Article |
| Aleksandr (Verified Customer) (12-16-2024) | Specific antibody! Applications: Western Blot Primary Antibody Dilution: 1:3000 Cell Tissue Type: RKO RBM7 Antibody Western Blot validation (1:3000 dilution) in RKO (Cat no:21896-1-AP) |
| Tsimafei (Verified Customer) (11-19-2024) | Great antibody that detect Rbm7 in U2OS cells Applications: Western Blot Primary Antibody Dilution: 1:2000 Cell Tissue Type: U2OS RBM7 Antibody Western Blot validation (1:2000 dilution) in U2OS (Cat no:21896-1-AP) |
| Moritz (Verified Customer) (08-20-2024) | I used this antibody to detect RBM7 with Western blot in HEK293T WT cell lysate, which worked perfectly. Applications: Western Blot Primary Antibody Dilution: 1:3000 Cell Tissue Type: HEK293T WT RBM7 Antibody Western Blot validation (1:3000 dilution) in HEK293T WT (Cat no:21896-1-AP) |
| Roy (Verified Customer) (06-15-2024) | Works well to detect the NEXT complex subunit RBM7 from HeLa extracts (1/1000 Dilution, overnight Incubation at 4°C). Applications: Western Blot Primary Antibody Dilution: 1/1000 Cell Tissue Type: HeLa |
| Citations | 7 |
| Dilutions | WB : 1:500-1:2000 IHC : 1:50-1:500 IF/ICC : 1:300-1:1200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
RBM7 (RNA-binding motif protein 7) is an RNA-binding protein initially described to associate with splicing factors, presumably to target intronic RNA for decay (PMID: 35688134). RBM7 regulates the nuclear degradation of NEAT1 non-coding RNA, resulting in sustained apoptosis in the lung epithelium and fibrosis (PMID: 32708315). Protocols Product Specific Protocols IF protocol for RBM7 antibody 21896-1-AP Download protocol IHC protocol for RBM7 antibody 21896-1-AP Download protocol WB protocol for RBM7 antibody 21896-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Temporal-iCLIP captures co-transcriptional RNA-protein interactions
Journal: Nat Commun | Authors: Ross A Cordiner - FBXW7 Targets the SPT6-ΔNp63 Axis for Degradation to Inhibit Esophageal Tumorigenesis Induced by 4-Nitroquinoline N-Oxide.
Journal: MedComm (2020) | Authors: Jiagui Zhang | Species: human | Application: WB - The NEXT complex regulates H3K27me3 levels to affect cancer progression by degrading G4/U-rich lncRNAs
Journal: Nucleic Acids Res | Authors: Qianqian Yang KD Validated | Species: human | Application: WB - P-TEFb Activation by RBM7 Shapes a Pro-survival Transcriptional Response to Genotoxic Stress.
Journal: Mol Cell | Authors: Andrii Bugai | Species: human | Application: WB - MYC binding to nascent RNA suppresses innate immune signaling by R-loop-derived RNA-DNA hybrids
Journal: Cell | Authors: Leonie Uhl - RBM7 suppresses mitochondrial dysfunction and ferroptosis by destabilizing FBXL16 mRNA to enhance Temozolomide resistance in glioblastoma.
Journal: Mol Genet Genomics | Authors: Nan Liu | Species: human | Application: WB - RBM7 suppresses mitochondrial dysfunction and ferroptosis by destabilizing FBXL16 mRNA to enhance Temozolomide resistance in glioblastoma.
Journal: Mol Genet Genomics | Authors: Nan Liu | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
