CoraLite®594-conjugated RBX1 Monoclonal antibody CL594-66716 proteintech
$479.00
In stock
SKU
CL594-66716
| Catalog Number | CL594-66716 |
| Synonyms | BA554C12.1, Protein ZYP, RBX1, Regulator of cullins 1, ring box 1, RING box protein 1, RING finger protein 75, RNF75, ROC1 |
| Host | Mouse |
| Reactivity | Human, Mouse, Rat |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Proclin300, BSA, Glycerol |
| Applications | IF/ICC |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive IF/ICC detected in | HeLa cells |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | Human, Mouse, Rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag7005 Product name: Recombinant human RBX1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-108 aa of BC001466 Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH Predict reactive species |
| Full Name | ring-box 1 |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12-15 kDa |
| GenBank Accession Number | BC001466 |
| Gene Symbol | RBX1 |
| Gene ID (NCBI) | 9978 |
| RRID | AB_2920026 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Purification Method | Protein G purification |
| UNIPROT ID | P62877 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. |
| IF protocol for CL594 RBX1 antibody CL594-66716 | Download protocol |
| Citations | - |
| Dilutions | IF/ICC : 1:50-1:500 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1F4D9 |
| Conjugation | CoraLite®594 |
RBX1(RING-box protein 1) is also named as RNF75, ROC1 and is a requisite component of the multi- subunit SCF family E3s36-40. It mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. Protocols Product Specific Protocols IF protocol for CL594 RBX1 antibody CL594-66716 Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
