Recoverin Polyclonal antibody 10073-1-AP proteintech
$149.00
In stock
SKU
10073-1-AP
| Catalog Number | 10073-1-AP |
| Synonyms | RCVRN, Cancer associated retinopathy protein, Cancer-associated retinopathy protein, Protein CAR, RCV1 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (2) |
| Reactivity | human, mouse, rat, pig, zebrafish |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF-P, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse eye tissue, rat retina tissue, Y79 cells, rat eye tissue |
| Tested Applications — Positive IP detected in | mouse eye tissue |
| Tested Applications — Positive IHC detected in | mouse eye tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse eye tissue, mouse brain tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:3000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive WB detected in | mouse eye tissue, rat retina tissue, Y79 cells, rat eye tissue |
| Positive IP detected in | mouse eye tissue |
| Positive IHC detected in | mouse eye tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse eye tissue, mouse brain tissue |
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, zebrafish |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag0119 Product name: Recombinant human Recoverin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-166 aa of BC001720 Sequence: GALSKEILEELQLNTKFSEEELCSWYQSFLKDCPTGRITQQQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDGTLDFKEYVIALHMTTAGKTNQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDK Predict reactive species |
| Full Name | recoverin |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC001720 |
| Gene Symbol | Recoverin |
| Gene ID (NCBI) | 5957 |
| RRID | AB_2178005 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35243 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for Recoverin antibody 10073-1-AP | Download protocol |
| IHC protocol for Recoverin antibody 10073-1-AP | Download protocol |
| IP protocol for Recoverin antibody 10073-1-AP | Download protocol |
| WB protocol for Recoverin antibody 10073-1-AP | Download protocol |
| human | IF Bioact Mater Micromolded honeycomb scaffold design to support the generation of a bilayered RPE and photoreceptor cell construct Authors - In-Kyu Lee View Article |
| zebrafish,human | IHC Nat Commun Exome-wide association study identifies KDELR3 mutations in extreme myopia Authors - Jian Yuan View Article |
| zebrafish | IF ACS Nano Maternal-Derived Polystyrene Nanoplastics Impair Early Retinal Development in Zebrafish (Danio rerio). Authors - Youyuan Zhuang View Article |
| mouse | IF NPJ Regen Med MAP4Ks inhibition promotes retinal neuron regeneration from Müller glia in adult mice Authors - Houjian Zhang View Article |
| Alessandro (Verified Customer) (07-27-2022) | No aspecific staining, great outcome Applications: Immunofluorescence Primary Antibody Dilution: 1:500 Cell Tissue Type: ROs |
| Citations | 27 |
| Dilutions | WB : 1:500-1:3000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Recoverin, belonging to a family of the neuronal calcium sensor (NCS) proteins, has a restricted expression in retinal photoreceptors or neurons or neuroendocrine cells. It has been suggested to play a role in light and dark adaptation by regulating rhodopsin phosphorylation. Recently, it has been found that autoantibodies against recoverin (24 kDa) have been strongly associated with cancer -associated retinopathy (CAR) syndrome, a paraneoplastic disease of the retina. But functions of recoverin in cancer cells remain unknown. Protocols Product Specific Protocols IF protocol for Recoverin antibody 10073-1-AP Download protocol IHC protocol for Recoverin antibody 10073-1-AP Download protocol IP protocol for Recoverin antibody 10073-1-AP Download protocol WB protocol for Recoverin antibody 10073-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Micromolded honeycomb scaffold design to support the generation of a bilayered RPE and photoreceptor cell construct
Journal: Bioact Mater | Authors: In-Kyu Lee | Species: human | Application: IF - Exome-wide association study identifies KDELR3 mutations in extreme myopia
Journal: Nat Commun | Authors: Jian Yuan | Species: zebrafish,human | Application: IHC - Maternal-Derived Polystyrene Nanoplastics Impair Early Retinal Development in Zebrafish (Danio rerio).
Journal: ACS Nano | Authors: Youyuan Zhuang | Species: zebrafish | Application: IF - A 3D human retina model reveals a non-cell-autonomous and non-neuronal mechanism of photoreceptor loss in a lysosomal storage disorder
Journal: Sci Transl Med | Authors: Jimin Han | Application: IF - A Nucleic Acid-Based LYTAC Plus Platform to Simultaneously Mediate Disease-Driven Protein Downregulation
Journal: Adv Sci (Weinh) | Authors: Yangyang Huang | Species: mouse | Application: IF - MAP4Ks inhibition promotes retinal neuron regeneration from Müller glia in adult mice
Journal: NPJ Regen Med | Authors: Houjian Zhang | Species: mouse | Application: IF - 6PPD and 6PPDQ embryonic exposure induced distinct developmental neurotoxicity in zebrafish
Journal: Ecotoxicol Environ Saf | Authors: Liang Yang | Species: zebrafish | Application: IHC - Inefficacy of anti-VEGF therapy reflected in VEGF-mediated photoreceptor degeneration
Journal: Mol Ther Nucleic Acids | Authors: Xin Xu | Species: human | Application: WB - Lactylated histone H4K8 regulation of MFN2/Wnt signaling integrates glycolytic metabolism and Müller cell activation in the pathogenesis of glaucoma.
Journal: Neurobiol Dis | Authors: Shiyuan Xiao | Species: mouse | Application: IF - Self-organization, quality control, and preclinical studies of human iPSC-derived retinal sheets for tissue-transplantation therapy
Journal: Commun Biol | Authors: Kenji Watari | Species: rat | Application: IF - Slc4a7 Regulates Retina Development in Zebrafish
Journal: Int J Mol Sci | Authors: Youyuan Zhuang | Species: zebrafish | Application: IF - A Porcine Model of Rhegmatogenous Retinal Detachment and Repair With Pars Plana Vitrectomy and Silicone Oil Tamponade.
Journal: Invest Ophthalmol Vis Sci | Authors: Jonathan F. Russell | Species: pig | Application: IHC - Microglia activation and neuronal alterations in retinas from COVID-19 patients: correlation with clinical parameters
Journal: Eye Vis (Lond) | Authors: Henar Albertos-Arranz | Species: human | Application: IF - Preconditioning the Initial State of Feeder-free Human Pluripotent Stem Cells Promotes Self-formation of Three-dimensional Retinal Tissue.
Journal: Sci Rep | Authors: Atsushi Kuwahara | Species: human | Application: IF - Microglia dynamics in retinitis pigmentosa model: formation of fundus whitening and autofluorescence as an indicator of activity of retinal degeneration.
Journal: Sci Rep | Authors: Kenichi Makabe | Species: mouse | Application: IF - Isoform-Specific Splicing of ANK2 by PTBP2 Orchestrates Retinal Pigment Epithelial-to-Neuron Fate Conversion.
Journal: J Neurochem | Authors: Yun-Xi Ma | Species: human | Application: IF - A Genetic modification that reduces ON-bipolar cells in hESC-derived retinas enhances functional integration after transplantation.
Journal: iScience | Authors: Suguru Yamasaki | Species: human | Application: IF - Identification of early-onset photoreceptor degeneration in transgenic mouse models of Alzheimer's disease.
Journal: iScience | Authors: Jie Zhang | Species: mouse | Application: WB - Identification of early-onset photoreceptor degeneration in transgenic mouse models of Alzheimer's disease.
Journal: iScience | Authors: Jie Zhang | Species: mouse | Application: WB - Differentiation of marrow stromal cells into photoreceptors in the rat eye.
Journal: J Neurosci | Authors: Kicic Anthony A | Species: rat | Application: WB - Addition of Chk1 inhibitor and BMP4 cooperatively promotes retinal tissue formation in self-organizing human pluripotent stem cell differentiation culture.
Journal: Regen Ther | Authors: Suguru Yamasaki | Species: human | Application: IF - Legumain affects the PI3K/AKT tumor progression pathway in retinoblastoma
Journal: Exp Eye Res | Authors: Qin Tang | Species: human | Application: WB - AAV2.7m8 transduction of stage 2 human retinal organoids induces highly variable responses in innate and inflammatory gene expression and cytokine secretion
Journal: Exp Eye Res | Authors: Monica M Sauter | Species: human | Application: IF - Clinical features and molecular mechanisms of RP1L1 variants causing occult macular dystrophy
Journal: HGG Adv | Authors: Yang Pan | Species: human | Application: WB - Transplanted olfactory ensheathing cells reduce retinal degeneration in Royal College of Surgeons rats.
Journal: Curr Eye Res | Authors: Huo Shu Jia SJ | Species: rat | Application: IHC - Protocol for differentiating patient-derived iPSCs into photoreceptor-like cells.
Journal: STAR Protoc | Authors: Yang Pan | Species: human | Application: WB - Evaluation of canine serum for the presence of antiretinal autoantibodies in sudden acquired retinal degeneration syndrome.
Journal: Vet Ophthalmol | Authors: Keller Rachel L RL | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
