REEP6 Polyclonal antibody 12088-1-AP proteintech
$149.00
In stock
SKU
12088-1-AP
| Catalog Number | 12088-1-AP |
| Synonyms | C19orf32, DP1L1, Polyposis locus protein 1-like 1, Receptor expression-enhancing protein 6 |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (1) |
| Reactivity | human, mouse, rat, pig |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | BxPC-3 cells, HepG2 cells, mouse liver tissue, rat liver tissue |
| Tested Applications — Positive IP detected in | BxPC-3 cells |
| Tested Applications — Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HepG2 cells, mouse olfactory epithelium tissue |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | BxPC-3 cells, HepG2 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | BxPC-3 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, mouse olfactory epithelium tissue |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag2723 Product name: Recombinant human REEP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC008201 Sequence: MDGLRQRVEHFLEQRNLVTEVLGALEAKTGVEKRYLAAGAVTLLSLYLLFGYGASLLCNLIGFVYPAYASIKAIESPSKDDDTVWLTYWVVYALFGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK Predict reactive species |
| Full Name | receptor accessory protein 6 |
| Calculated Molecular Weight | 201 aa, 22 kDa |
| Observed Molecular Weight | 17-22 kDa |
| GenBank Accession Number | BC008201 |
| Gene Symbol | REEP6 |
| Gene ID (NCBI) | 92840 |
| RRID | AB_2178460 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96HR9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for REEP6 antibody 12088-1-AP | Download protocol |
| IHC protocol for REEP6 antibody 12088-1-AP | Download protocol |
| IP protocol for REEP6 antibody 12088-1-AP | Download protocol |
| WB protocol for REEP6 antibody 12088-1-AP | Download protocol |
| mouse | IF Hum Mol Genet REEP6 deficiency leads to retinal degeneration through disruption of ER homeostasis and protein trafficking. Authors - Smriti A Agrawal View Article |
| rat | WB J Clin Invest Nasal neuron PET imaging quantifies neuron generation and degeneration. Authors - Genevieve C Van de Bittner View Article |
| human | WB,IHC Int J Biol Macromol Receptor accessory protein 6, a novel ferroptosis suppressor, drives oral squamous cell carcinoma by maintaining endoplasmic reticulum hemostasis Authors - Lingyun Xia View Article |
| pig | IHC bioRxiv RHO1-2 meganuclease gene editing targets human P23H rhodopsin-induced retinitis pigmentosa to rejuvenate rods and maintain cones. Authors - Archana Jalligampala View Article |
| Citations | 6 |
| Dilutions | WB : 1:1000-1:6000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Dysfunctional tubular endoplasmic reticulum constitutes a pathological feature of Alzheimer's disease.
Journal: Mol Psychiatry | Authors: M G Sharoar | Species: mouse | Application: IP - Nasal neuron PET imaging quantifies neuron generation and degeneration.
Journal: J Clin Invest | Authors: Genevieve C Van de Bittner | Species: rat | Application: WB - Mutations in REEP6 Cause Autosomal-Recessive Retinitis Pigmentosa.
Journal: Am J Hum Genet | Authors: Gavin Arno | Species: human | Application: WB,IF - REEP6 deficiency leads to retinal degeneration through disruption of ER homeostasis and protein trafficking.
Journal: Hum Mol Genet | Authors: Smriti A Agrawal | Species: mouse | Application: IF - RHO1-2 meganuclease gene editing targets human P23H rhodopsin-induced retinitis pigmentosa to rejuvenate rods and maintain cones.
Journal: bioRxiv | Authors: Archana Jalligampala | Species: pig | Application: IHC - Receptor accessory protein 6, a novel ferroptosis suppressor, drives oral squamous cell carcinoma by maintaining endoplasmic reticulum hemostasis
Journal: Int J Biol Macromol | Authors: Lingyun Xia | Species: human | Application: WB,IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
