RNPS1 Polyclonal antibody 32844-1-AP proteintech
$149.00
In stock
SKU
32844-1-AP
| Catalog Number | 32844-1-AP |
| Synonyms | E5.1, LDC2, RNA-binding protein with serine-rich domain 1, RNPS 1, SR-related protein LDC2 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, Raji cells, Ramos cells, fetal human brain tissue |
| Tested Applications — Positive IP detected in | HEK-293 cells |
| Tested Applications — Positive IF/ICC detected in | HEK-293 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HEK-293 cells, Raji cells, Ramos cells, fetal human brain tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IF/ICC detected in | HEK-293 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag37888 Product name: Recombinant human RNPS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-239 aa of BC001838 Sequence: PKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVL Predict reactive species |
| Full Name | RNA binding protein S1, serine-rich domain |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC001838 |
| Gene Symbol | RNPS1 |
| Gene ID (NCBI) | 10921 |
| RRID | AB_3742761 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15287 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for RNPS1 antibody 32844-1-AP | Download protocol |
| IP protocol for RNPS1 antibody 32844-1-AP | Download protocol |
| WB protocol for RNPS1 antibody 32844-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:2000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The splicing process of mRNA must be highly precise to carry the correct genetic information to the cytoplasm as templates for translation. And this process involves more than 50 proteins in the splicing complex. RNPS1 is a versatile factor that regulates alternative splicing of a number of pre-mRNAs. It participates in both constitutive splicing and in distinctive modulation of alternative splicing in a substrate dependent manner, and involved in UPF2-dependent nonsense-mediated decay (NMD) of mRNAs containing premature stop codons. Its ser-53 phosphorylation site is important for splicing and translation stimulation activity in vitro. The molecular weight observed is consistent with what has been described in the literature (PMID: 39687031/PMID: 10449421). RNPS1 is a nucleocytoplasmic shuttling protein. Protocols Product Specific Protocols IF protocol for RNPS1 antibody 32844-1-AP Download protocol IP protocol for RNPS1 antibody 32844-1-AP Download protocol WB protocol for RNPS1 antibody 32844-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
