ROPN1B Polyclonal antibody 34136-1-AP proteintech
$149.00
In stock
SKU
34136-1-AP
| Catalog Number | 34136-1-AP |
| Synonyms | Rhophilin-associated protein 1B, Ropporin-1B |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | human testis tissue, mouse testis tissue, rat testis tissue |
| Tested Applications — Positive IHC detected in | rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Positive WB detected in | human testis tissue, mouse testis tissue, rat testis tissue |
| Positive IHC detected in | rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag10787 Product name: Recombinant human ROPN1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC015413 Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE Predict reactive species |
| Full Name | ropporin, rhophilin associated protein 1B |
| Calculated Molecular Weight | 120 aa, 24 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC015413 |
| Gene Symbol | ROPN1B |
| Gene ID (NCBI) | 152015 |
| RRID | AB_3743160 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9BZX4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for ROPN1B antibody 34136-1-AP | Download protocol |
| WB protocol for ROPN1B antibody 34136-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:2000-1:12000 IHC : 1:300-1:1200 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Ropporin-1B (ROPN1B), cancer-restricted antigen, is highly expressed and immunogenic, inducing humoral immunity in patients with advanced metastatic melanoma (PMID: 33918976). It is important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, it plays a role in PKA-dependent signaling processes required for spermatozoa capacitation (PMID: 23303679). Protocols Product Specific Protocols IHC protocol for ROPN1B antibody 34136-1-AP Download protocol WB protocol for ROPN1B antibody 34136-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
