RPS6KB2 Polyclonal antibody 26194-1-AP proteintech
$149.00
In stock
SKU
26194-1-AP
| Catalog Number | 26194-1-AP |
| Synonyms | KLS, P70 beta, P70 beta 1, P70 beta 2, p70 ribosomal S6 kinase beta, p70 S6 kinase beta, p70 S6K 2, p70 S6K beta, p70 S6KB, p70(S6K) beta, P70S6K2, p70S6Kb, RPS6KB2, S6 kinase related kinase, S6K beta, S6K beta 2, S6K beta2, S6K2, SRK, STK14B |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | MCF-7 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:2000 |
| Positive WB detected in | MCF-7 cells |
| Western Blot (WB) | WB : 1:500-1:2000 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag23800 Product name: Recombinant human RPS6KB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC000094 Sequence: MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELT Predict reactive species |
| Full Name | ribosomal protein S6 kinase, 70kDa, polypeptide 2 |
| Calculated Molecular Weight | 53 kDa |
| Observed Molecular Weight | 54 kDa |
| GenBank Accession Number | BC000094 |
| Gene Symbol | RPS6KB2 |
| Gene ID (NCBI) | 6199 |
| RRID | AB_2880419 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UBS0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for RPS6KB2 antibody 26194-1-AP | Download protocol |
| human | WB bioRxiv The long non-coding RNA, CyKILRb, augments oncogenic phenotypes via induction of PIK3R2 and activation of the PI (3) K/AKT axis. Authors - Xiujie Xie View Article |
| Citations | 3 |
| Dilutions | WB : 1:500-1:2000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Human eIF2A has a minimal role in translation initiation and in uORF-mediated translational control in HeLa cells
Journal: Elife | Authors: Mykola Roiuk | Species: human | Application: WB - The long non-coding RNA, CyKILRb, augments oncogenic phenotypes via induction of PIK3R2 and activation of the PI (3) K/AKT axis.
Journal: bioRxiv | Authors: Xiujie Xie | Species: human | Application: WB - The lncRNA, CyKILRb acts as a ceRNA for tumor suppressive microRNA to augment oncogenic phenotype via induction of PIK3R2/PI(3)K/AKT axis.
Journal: Mol Ther Nucleic Acids | Authors: Xiujie Xie
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
