RRN3 Polyclonal antibody 25918-1-AP proteintech
$149.00
In stock
SKU
25918-1-AP
| Catalog Number | 25918-1-AP |
| Synonyms | RNA polymerase I-specific transcription initiation factor RRN3, TIF IA, TIFIA, TIF-IA |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IP, chIP, ELISA |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Jurkat cells, HeLa cells, K-562 cells, mouse testis tissue |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Positive WB detected in | Jurkat cells, HeLa cells, K-562 cells, mouse testis tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag23207 Product name: Recombinant human RRN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-365 aa of BC132688 Sequence: ETATQTCGGTDSTEGLFNMDEDEETEHETKAGPERLDQMVHPVAERLDILMSLVLSYMKDVCYVDGKVDNGKTKDLYRDLINIFDKLLLPTHASCHVQ Predict reactive species |
| Full Name | RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae) |
| Observed Molecular Weight | 74 kDa |
| GenBank Accession Number | BC132688 |
| Gene Symbol | RRN3 |
| Gene ID (NCBI) | 54700 |
| RRID | AB_2880296 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NYV6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for RRN3 antibody 25918-1-AP | Download protocol |
| IP protocol for RRN3 antibody 25918-1-AP | Download protocol |
| WB protocol for RRN3 antibody 25918-1-AP | Download protocol |
| human | WB Mol Biol Cell A role for the kinetochore protein, NUF2, in ribosome biogenesis Authors - Ty J Brown View Article |
| mouse | WB J Mol Cell Cardiol Transcription initiation factor-1A regulates the contraction of vascular smooth muscle and maintains blood pressure. Authors - Xiaolin Yue View Article |
| Citations | 4 |
| Dilutions | WB : 1:1000-1:4000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:250-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
RRN3, also known as transcription initiation factor IA, is a key regulatory protein essential for RNA polymerase I-mediated ribosomal DNA transcription. It functions as a bridge molecule that precisely regulates the recruitment of RNA polymerase I to the rDNA promoter and the assembly of the transcription initiation complex by integrating intra- and extracellular signals (such as growth factors, nutrient status, and cellular stress). The activity of RRN3 is tightly controlled by multiple signaling pathways. Specifically, the mTOR and MAPK pathways can activate RRN3 through phosphorylation, thereby promoting ribosomal RNA synthesis and ultimately influencing cell growth and proliferation. Studies have shown that RRN3 is abnormally highly expressed in various cancer cells and is closely associated with malignant tumor progression, making it a potential therapeutic target for anticancer strategies. Protocols Product Specific Protocols IHC protocol for RRN3 antibody 25918-1-AP Download protocol IP protocol for RRN3 antibody 25918-1-AP Download protocol WB protocol for RRN3 antibody 25918-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Nucleolar localization signal and histone methylation reader function is required for SPIN1 to promote rRNA gene expression.
Journal: Biochem Biophys Res Commun | Authors: Xiaolei Zhang | Species: human | Application: chIP - Transcription initiation factor-1A regulates the contraction of vascular smooth muscle and maintains blood pressure.
Journal: J Mol Cell Cardiol | Authors: Xiaolin Yue | Species: mouse | Application: WB - Control of ribosomal RNA synthesis by hematopoietic transcription factors
Journal: Mol Cell | Authors: Charles Antony | Application: WB - A role for the kinetochore protein, NUF2, in ribosome biogenesis
Journal: Mol Biol Cell | Authors: Ty J Brown | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
