PKC Alpha Polyclonal antibody 21991-1-AP proteintech
$149.00
In stock
SKU
21991-1-AP
| Catalog Number | 21991-1-AP |
| Synonyms | PRKCA, AAG6, EC:2.7.11.13, PKC A, PKCA |
| Host | Rabbit |
| Reactivity | human, mouse, rat and More (3) |
| Reactivity | human, mouse, rat, pig, monkey, chicken |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells, human peripheral blood platelets, rat kidney tissue |
| Tested Applications — Positive IP detected in | NIH/3T3 cells |
| Tested Applications — Positive IHC detected in | human thyroid cancer tissue, mouse brain tissue, mouse eye tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | rat eye tissue |
| Tested Applications — Positive IF/ICC detected in | HeLa cells, NIH/3T3 cells, HepG2 cells |
| Tested Applications — Positive FC (Intra) detected in | HeLa cells, Jurkat cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Recommended Dilutions — Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells, human peripheral blood platelets, rat kidney tissue |
| Positive IP detected in | NIH/3T3 cells |
| Positive IHC detected in | human thyroid cancer tissue, mouse brain tissue, mouse eye tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat eye tissue |
| Positive IF/ICC detected in | HeLa cells, NIH/3T3 cells, HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells, Jurkat cells |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag17275 Product name: Recombinant human PRKCA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-216 aa of BC109274 Sequence: MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIR Predict reactive species |
| Full Name | protein kinase C, alpha |
| Calculated Molecular Weight | 77 kDa |
| Observed Molecular Weight | 77 kDa |
| GenBank Accession Number | AK055431 |
| Gene Symbol | PKC Alpha |
| Gene ID (NCBI) | 5578 |
| RRID | AB_2878965 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17252 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| FC protocol for PKC Alpha antibody 21991-1-AP | Download protocol |
| IF protocol for PKC Alpha antibody 21991-1-AP | Download protocol |
| IHC protocol for PKC Alpha antibody 21991-1-AP | Download protocol |
| IP protocol for PKC Alpha antibody 21991-1-AP | Download protocol |
| WB protocol for PKC Alpha antibody 21991-1-AP | Download protocol |
| mouse | WB Adv Sci (Weinh) LncRNA Foxo6os as a Novel " Scaffold" Mediates MYBPC3 in Combating Pathological Cardiac Hypertrophy and Heart Failure Authors - Jie Sheng View Article |
| human | WB Oncogene β-Trcp and CK1δ-mediated degradation of LZTS2 activates PI3K/AKT signaling to drive tumorigenesis and metastasis in hepatocellular carcinoma. Authors - Yanwei Lu View Article |
| Mounika (Verified Customer) (09-02-2026) | works very well, helped our project. Applications: Western Blot, Immunohistochemistry, Immunofluorescence Primary Antibody Dilution: 1:1000 |
| Gaurav (Verified Customer) (12-05-2025) | Works with Primary Cells Applications: Western Blot, Flow Cytometry, Cell culture Primary Antibody Dilution: 1:3000 Cell Tissue Type: Primary Aortic SMCs |
| Alessandro (Verified Customer) (11-07-2022) | no unspecific staining, great outcome Applications: Immunofluorescence |
| Chiara (Verified Customer) (10-04-2021) | Works very well in Immunoblot Applications: Western Blot Primary Antibody Dilution: 1000 Cell Tissue Type: mesenchymal Stem cell |
| Samantha (Verified Customer) (02-24-2020) | Bovine vascular smooth muscle cells were transfected with either control siRNA or PKCalpha siRNA for up to 7 days, with transfections repeated every 48-72 hours. Blocking agent: 5% (w/v) milk in TBST for 1hrPrimary antibody diluted in 5% (w/v) milk in TBST; incubated overnight at 4 degrees. Applications: Western Blot, Primary Antibody Dilution: 1:750 Cell Tissue Type: Bovine vascular smooth muscle cells PKC Alpha Antibody Western Blot, validation (1:750 dilution) in Bovine vascular smooth muscle cells (Cat no:21991-1-AP) |
| Ryan (Verified Customer) (01-10-2018) | Applications: Immunohistochemistry, Primary Antibody Dilution: 1:100 Cell Tissue Type: Zebrafish Retina PKC Alpha Antibody Immunohistochemistry, validation (1:100 dilution) in Zebrafish Retina (Cat no:21991-1-AP) |
| Citations | 80 |
| Dilutions | WB : 1:2000-1:12000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:20-1:200 IF-P : 1:50-1:500 IF/ICC : 1:50-1:500 FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. PRKCA is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes. Protocols Product Specific Protocols FC protocol for PKC Alpha antibody 21991-1-AP Download protocol IF protocol for PKC Alpha antibody 21991-1-AP Download protocol IHC protocol for PKC Alpha antibody 21991-1-AP Download protocol IP protocol for PKC Alpha antibody 21991-1-AP Download protocol WB protocol for PKC Alpha antibody 21991-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- LncRNA Foxo6os as a Novel " Scaffold" Mediates MYBPC3 in Combating Pathological Cardiac Hypertrophy and Heart Failure
Journal: Adv Sci (Weinh) | Authors: Jie Sheng | Species: mouse | Application: WB - RSK2-mediated phosphorylation and degradation of UBE2O inhibits hepatocellular carcinoma growth and resistance to radiotherapy
Journal: Cancer Lett | Authors: Yumei Huang | Species: human - MED13L integrates Mediator-regulated epigenetic control into lung cancer radiosensitivity.
Journal: Theranostics | Authors: Nasha Zhang | Species: human | Application: WB - ATF4/CEMIP/PKCα promotes anoikis resistance by enhancing protective autophagy in prostate cancer cells.
Journal: Cell Death Dis | Authors: Ying Yu | Species: human | Application: IF - β-Trcp ubiquitin ligase and RSK2 kinase-mediated degradation of FOXN2 promotes tumorigenesis and radioresistance in lung cancer.
Journal: Cell Death Differ | Authors: Jia Ma | Species: human | Application: WB - β-Trcp and CK1δ-mediated degradation of LZTS2 activates PI3K/AKT signaling to drive tumorigenesis and metastasis in hepatocellular carcinoma.
Journal: Oncogene | Authors: Yanwei Lu | Species: human | Application: WB
Reviews
Write Your Own Review