RYR3 Monoclonal antibody, PBS Only (Capture) 68730-1-PBS proteintech
$699.00
In stock
SKU
68730-1-PBS
| Catalog Number | 68730-1-PBS |
| Synonyms | Brain type ryanodine receptor, HBRR, ryanodine receptor 3, RYR 3 |
| Host | Mouse |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag25978 Product name: Recombinant human RYR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 587-686 aa of NM_001036 Sequence: MLLDKHGRNHKVLDILCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINDVTSIRPNIFLGVAEGSAQYKKWYFELIIDQVDPFLTAEPTHLRVGWAS Predict reactive species |
| Full Name | ryanodine receptor 3 |
| Calculated Molecular Weight | 552 kDa |
| GenBank Accession Number | NM_001036 |
| Gene Symbol | RYR3 |
| Gene ID (NCBI) | 6263 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q15413 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 2B2D11 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
