Mouse NF-κB p65 Recombinant monoclonal antibody, PBS Only (Capture) 87545-5-PBS proteintech
$699.00
In stock
SKU
87545-5-PBS
| Catalog Number | 87545-5-PBS |
| Synonyms | PBS Only |
| Host | Rabbit |
| Reactivity | mouse |
| Form | Liquid |
| Applications | Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag40017 Product name: Recombinant mouse Rela protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 425-549 aa of BC094053 Sequence: KSTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPGVFTDLASVDNSEFQQLLNQGVSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPTPLGTSGLPNGLSGDEDFSSIADMDFSALLSQISS* Predict reactive species |
| Full Name | v-rel reticuloendotheliosis viral oncogene homolog A (avian) |
| GenBank Accession Number | BC094053 |
| Gene Symbol | Rela |
| Gene ID (NCBI) | 19697 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q04207 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 252936D6 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
