S100A7/Psoriasin Polyclonal antibody 26656-1-AP proteintech
$149.00
In stock
SKU
26656-1-AP
| Catalog Number | 26656-1-AP |
| Synonyms | Protein S100 A7, PSOR1, Psoriasin, S100A7, S100A7/Psoriasin, S100A7c |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | MCF-7 cells, MDA-MB-468 cells |
| Tested Applications — Positive IHC detected in | human oesophagus cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive WB detected in | MCF-7 cells, MDA-MB-468 cells |
| Positive IHC detected in | human oesophagus cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag24717 Product name: Recombinant human S100A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-35 aa of BC034687 Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTM Predict reactive species |
| Full Name | S100 calcium binding protein A7 |
| Calculated Molecular Weight | 101 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC034687 |
| Gene Symbol | S100A7/Psoriasin |
| Gene ID (NCBI) | 6278 |
| RRID | AB_2880592 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P31151 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for S100A7/Psoriasin antibody 26656-1-AP | Download protocol |
| WB protocol for S100A7/Psoriasin antibody 26656-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:1000 IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
S100A7 (psoriasin), a member of the S100 protein family, is a well-known antimicrobial peptide and a signaling molecule which regulates cellular function and is expressed in many squamous cell carcinomas (SCCs), such as SCC of the skin. It is an EF-hand type calcium binding protein localized in epithelial cells, regulates cell proliferation and differentiation. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities. Protocols Product Specific Protocols IHC protocol for S100A7/Psoriasin antibody 26656-1-AP Download protocol WB protocol for S100A7/Psoriasin antibody 26656-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
