S100A8 Recombinant monoclonal antibody, PBS Only (Capture) 82531-3-PBS proteintech
$699.00
In stock
SKU
82531-3-PBS
| Catalog Number | 82531-3-PBS |
| Synonyms | CAGA, Calgranulin A, Calgranulin-A, Calprotectin L1L subunit, CFAG |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IF/ICC, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Eg3752 Product name: Recombinant Human S100A8 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-93 aa of BC005928 Sequence: MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE Predict reactive species |
| Full Name | S100 calcium binding protein A8 |
| Calculated Molecular Weight | 93 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC005928 |
| Gene Symbol | S100A8 |
| Gene ID (NCBI) | 6279 |
| RRID | AB_3743408 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P05109 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 242970G12 |
| Conjugation | Unconjugated |
S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine.
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
