S100A9 Recombinant monoclonal antibody, PBS Only 83578-1-PBS proteintech
$699.00
In stock
SKU
83578-1-PBS
| Catalog Number | 83578-1-PBS |
| Synonyms | CAGB, Calgranulin B, Calgranulin-B, Calprotectin L1H subunit, CFAG |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag25764 Product name: Recombinant human S100A9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-114 aa of BC047681 Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP Predict reactive species |
| Full Name | S100 calcium binding protein A9 |
| Calculated Molecular Weight | 13 kDa |
| GenBank Accession Number | BC047681 |
| Gene Symbol | S100A9 |
| Gene ID (NCBI) | 6280 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | P06702 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240539A8 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
