SAFB Polyclonal antibody 21857-1-AP proteintech
$149.00
In stock
SKU
21857-1-AP
| Catalog Number | 21857-1-AP |
| Synonyms | SAF B1, SAF B, HSP27 estrogen response element-TATA box-binding protein, HSP27 ERE-TATA-binding protein, HET |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HepG2 cells, HEK-293 cells, HeLa cells, MCF-7 cells, A431 cells, HCT 116 cells, COLO 320 cells |
| Tested Applications — Positive IHC detected in | mouse testis tissue, human testis tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | A431 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Positive WB detected in | HepG2 cells, HEK-293 cells, HeLa cells, MCF-7 cells, A431 cells, HCT 116 cells, COLO 320 cells |
| Positive IHC detected in | mouse testis tissue, human testis tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag16451 Product name: Recombinant human SAFB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 58-213 aa of BC126219 Sequence: MERLKKAIEDEGGNPDEIEITSEGNKKTSKRSSKGRKPEEEGVEDNGLEENSGDGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFTILQEIEEPSLEPE Predict reactive species |
| Full Name | scaffold attachment factor B |
| Calculated Molecular Weight | 917 aa, 103 kDa |
| Observed Molecular Weight | 150 kDa |
| GenBank Accession Number | BC126219 |
| Gene Symbol | SAFB |
| Gene ID (NCBI) | 6294 |
| RRID | AB_2878928 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15424 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SAFB antibody 21857-1-AP | Download protocol |
| IHC protocol for SAFB antibody 21857-1-AP | Download protocol |
| WB protocol for SAFB antibody 21857-1-AP | Download protocol |
| human | IF Cell Rep Stress-induced TDP-43 nuclear condensation causes splicing loss of function and STMN2 depletion Authors - Wan-Ping Huang View Article |
| mouse | IF Mol Cell SAFB restricts contact domain boundaries associated with L1 chimeric transcription Authors - Yaqiang Hong View Article |
| Moritz (Verified Customer) (09-26-2025) | worked well for the detection of mouse safb protein Applications: Western Blot Primary Antibody Dilution: 1:5000 Cell Tissue Type: mESCs SAFB Antibody Western Blot validation (1:5000 dilution) in mESCs (Cat no:21857-1-AP) |
| Aleksandr (Verified Customer) (12-16-2024) | Antibody does recognise the band of the expected molecular weight of SafB protein, however other non-specific bands are also visible Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: RKO SAFB Antibody Western Blot validation (1:1000 dilution) in RKO (Cat no:21857-1-AP) |
| Tsimafei (Verified Customer) (11-19-2024) | Antibody detect a band below 150 kDa in HEK293T cells Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: HEK293T SAFB Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:21857-1-AP) |
| Izortze (Verified Customer) (10-02-2024) | Great antibody for immunoprecipitation! Applications: Immunoprecipitation Cell Tissue Type: EndoCb-H1 cell line SAFB Antibody Immunoprecipitation validation ( dilution) in EndoCb-H1 cell line (Cat no:21857-1-AP) |
| Julia (Verified Customer) (08-07-2024) | Used antibody for mESC protein extract. Band of the correct size is visible, additional band at ~75kDa. Stains ladder but otherwise good. Applications: Western Blot Primary Antibody Dilution: 1:5000 Cell Tissue Type: mESC SAFB Antibody Western Blot validation (1:5000 dilution) in mESC (Cat no:21857-1-AP) |
| Tatyana (Verified Customer) (12-04-2023) | Good signal in ICC, can be used to detect nuclear stress bodies (nSBs) Applications: Immunofluorescence Primary Antibody Dilution: 1:1000 Cell Tissue Type: Human / HeLa cells SAFB Antibody Immunofluorescence validation (1:1000 dilution) in Human / HeLa cells (Cat no:21857-1-AP) |
| Bibha (Verified Customer) (06-05-2019) | I used this antibody in human primary astrocytes Mock-infected or infected with Venezuelan equine encephalitis virus. Applications: Western Blot, Primary Antibody Dilution: 1:1000 Cell Tissue Type: Human primary astrocytes SAFB Antibody Western Blot, validation (1:1000 dilution) in Human primary astrocytes (Cat no:21857-1-AP) |
| Citations | 10 |
| Dilutions | WB : 1:5000-1:50000 IHC : 1:50-1:500 IF/ICC : 1:200-1:800 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Heterogeneous nuclear ribonucleoproteins (hnRNPs) constitute a set of polypeptides that contribute to pre-mRNA processing and transport. hnRNPs also bind heterogeneous nuclear RNA (hnRNA), the transcripts produced by RNA polymerase II. SAFB (scaffold attachment factor B) is a nuclear matrix-associated protein that binds to matrix- or scaffold-associating regions (MARs or SARs) on DNA and interacts with RNA polymerase II and serine-/arginine-rich RNA processing factors (SR proteins). SAFB, also designated HAP (hnRNP A1 associated protein) and HET (HSP 27-ERE-TATA-binding protein) is a proven hnRNP protein that has a speckled distribution in the nucleus and, in response to stress agents such as heat shock, is recruited to a few, large nuclear granules, called perichromatin granules. SAFB also binds to the estrogen receptor (ER) and is expressed in several breast cancer cell lines at varying levels. Subsequently, SAFB may play a role in breast cancer by mediating cellular proliferation and division. This antibody specifically reacts whith the isoform 1 of human SAFB protein. SF3A1, also known as SF3a120, is a 793 amino acid protein, which is a Subunit of the splicing factor SF3A required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. SF3A1 also be involved in the assembly of the 'E' complex. The calculated molecular weight of SAFB is 103 kDa, but the modified SAFB is about 130-175 kDa.(PMID: 28469965, PMID: 26273616 ) Protocols Product Specific Protocols IF protocol for SAFB antibody 21857-1-AP Download protocol IHC protocol for SAFB antibody 21857-1-AP Download protocol WB protocol for SAFB antibody 21857-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- FOCAS: Transcriptome-wide screening of individual m(6)A sites functionally dissects epitranscriptomic control of gene expression in cancer.
Journal: Cell | Authors: Xinning Zhang | Species: human | Application: WB - WNT2B impairs endosomal trafficking via WASHC5 to inhibit autophagy: a novel non-secretory WNT pathway.
Journal: Autophagy | Authors: Danqiong Liu | Species: human | Application: WB - SAFB restricts contact domain boundaries associated with L1 chimeric transcription
Journal: Mol Cell | Authors: Yaqiang Hong | Species: mouse | Application: IF - USP5 regulates purine metabolism and represents a therapeutic target in esophageal cancer.
Journal: Cell Death Dis | Authors: Kexin Zhao | Species: human | Application: WB - Stress-induced TDP-43 nuclear condensation causes splicing loss of function and STMN2 depletion
Journal: Cell Rep | Authors: Wan-Ping Huang | Species: human | Application: IF - PATZ1 condensation adjacent to PML nuclear bodies suppresses HBoV transcription as an intrinsic antiviral defense.
Journal: Cell Rep | Authors: Chuchu Tian - Discovery of Thermal Sensitizers That Inhibit Heat-Induced SAFB Granule Formation.
Journal: J Med Chem | Authors: Yuji Furutani | Species: human | Application: WB - RBM45 associates with nuclear stress bodies and forms nuclear inclusions during chronic cellular stress and in neurodegenerative diseases.
Journal: Acta Neuropathol Commun | Authors: Mahlon Collins | Species: human | Application: IF - ALS-linked cytoplasmic FUS assemblies are compositionally different from physiological stress granules and sequester hnRNPA3, a novel modifier of FUS toxicity.
Journal: Neurobiol Dis | Authors: Haiyan An | Species: human | Application: IF - ERH elicits cell lineage restriction in mammalian preimplantation development and differentiation from pluripotency via H3K9me3-heterochromatin.
Journal: Nat Commun | Authors: Andrew Katznelson | Species: human | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
