SALL1 Polyclonal antibody 27761-1-AP proteintech
$149.00
In stock
SKU
27761-1-AP
| Catalog Number | 27761-1-AP |
| Synonyms | HSAL1, Sal 1, Sal like protein 1, SAL1, TBS |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | IHC, IF-P, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | mouse testis tissue, human placenta tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF-P detected in | mouse brain tissue |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Recommended Dilutions — Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Positive IHC detected in | mouse testis tissue, human placenta tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag26766 Product name: Recombinant human SALL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 558-670 aa of NM_001127892 Sequence: MPLPPTLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMVTNSVPTASSSVLSSPAADCGPAGSATTFTNPLLPLMSEQF Predict reactive species |
| Full Name | sal-like 1 (Drosophila) |
| Calculated Molecular Weight | 140 kDa |
| Observed Molecular Weight | 140 kDa |
| GenBank Accession Number | NM_001127892 |
| Gene Symbol | SALL1 |
| Gene ID (NCBI) | 6299 |
| RRID | AB_3742255 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NSC2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SALL1 antibody 27761-1-AP | Download protocol |
| IHC protocol for SALL1 antibody 27761-1-AP | Download protocol |
| Citations | - |
| Dilutions | IHC : 1:50-1:500 IF-P : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SALL1(Sal-like protein 1), also known as SAL1. It is located in the cytoplasm and nucleus. The protein is mainly expressed in the kidney. Transcriptional repressor involved in organogenesis. The protein plays an essential role in ureteric bud invasion during kidney development. The molecular weight of SALL1 is 140 kDa. Protocols Product Specific Protocols IF protocol for SALL1 antibody 27761-1-AP Download protocol IHC protocol for SALL1 antibody 27761-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
