SCAMP3 Monoclonal antibody 67932-1-Ig proteintech
$149.00
In stock
SKU
67932-1-Ig
| Catalog Number | 67932-1-Ig |
| Synonyms | C1orf3, PROPIN1, SCAMP3 |
| Host | Mouse |
| Reactivity | Human, rat, mouse |
| Reactivity | human, rat, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Applications — Positive WB detected in | K-562 cells, MCF-7 cells, LNCaP cells, A549 cells, Hela cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Positive WB detected in | K-562 cells, MCF-7 cells, LNCaP cells, A549 cells, Hela cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Tested Reactivity | Human, rat, mouse |
| Cited Reactivity | mouse |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag26073 Product name: Recombinant human SCAMP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-96 aa of BC000161 Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQPSRKLSPTEPKNYGSYSTQASAAAAT Predict reactive species |
| Full Name | secretory carrier membrane protein 3 |
| Calculated Molecular Weight | 38 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC000161 |
| Gene Symbol | SCAMP3 |
| Gene ID (NCBI) | 10067 |
| RRID | AB_2918684 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | O14828 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SCAMP3 antibody 67932-1-Ig | Download protocol |
| WB protocol for SCAMP3 antibody 67932-1-Ig | Download protocol |
| mouse | WB,IF bioRxiv The copper chaperone ATOX1 exhibits differential protein-protein interactions and contributes to skeletal myoblast differentiation. Authors - Nathan Ferguson View Article |
| Citations | 1 |
| Dilutions | WB : 1:2000-1:10000 IF/ICC : 1:400-1:1600 |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1C1E6 |
| Conjugation | Unconjugated |
Publications
- The copper chaperone ATOX1 exhibits differential protein-protein interactions and contributes to skeletal myoblast differentiation.
Journal: bioRxiv | Authors: Nathan Ferguson | Species: mouse | Application: WB,IF
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
