SCAMP5 Polyclonal antibody 30328-1-AP proteintech
$149.00
In stock
SKU
30328-1-AP
| Catalog Number | 30328-1-AP |
| Synonyms | DKFZp686L1799, hSCAMP5, SCAMP5 |
| Host | Rabbit |
| Reactivity | Human, mouse and More (1) |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | mouse brain tissue, mouse brain tissue (incubated at 37°C) |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:8000 |
| Positive WB detected in | mouse brain tissue, mouse brain tissue (incubated at 37°C) |
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Tested Reactivity | Human, mouse |
| Cited Reactivity | mouse, rat |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag31837 Product name: Recombinant human SCAMP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-235 aa of BC024700 Sequence: SMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM Predict reactive species |
| Full Name | secretory carrier membrane protein 5 |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | BC024700 |
| Gene Symbol | SCAMP5 |
| Gene ID (NCBI) | 192683 |
| RRID | AB_3086295 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TAC9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for SCAMP5 antibody 30328-1-AP | Download protocol |
| mouse, rat | WB Adv Sci (Weinh) Deficiency of SCAMP5 Triggers Pancreatic β-Cell Secretory Dysfunction and Apoptosis. Authors - Yingqi Zhang KD Validated View Article |
| Citations | 1 |
| Dilutions | WB : 1:1000-1:8000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Secretory carrier-associated membrane protein 5 (SCAMP5) belongs to the to the SCAMP family. Secretory carrier membrane proteins (SCAMPs) constitute a group of membrane transport proteins in plants, insects and mammals. The mammalian genome contains five types of SCAMP genes, namely, SCAMP1-SCAMP5. (PMID:36217917, PMID:19234194). SCAMPs participate in the vesicle cycling fusion of vesicles and cell membranes and play roles in regulating exocytosis and endocytosis, activating synaptic function and transmitting nerve signals. Among these proteins, SCAMP5 is highly expressed in the brain and has direct or indirect effects on the function of the central nervous system (PMID:36217917). SCAMP5 regulates membrane transport, controls the exocytosis of synaptic vesicles and is related to secretion carrier and membrane function. In addition, SCAMP5 plays a major role in the normal maintenance of the physiological functions of nerve cells (PMID:36217917, PMID:33663553). For optimal WB detection of this membrane protein, we recommend to avoid boiling the sample after lysis. Protocols Product Specific Protocols WB protocol for SCAMP5 antibody 30328-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Deficiency of SCAMP5 Triggers Pancreatic β-Cell Secretory Dysfunction and Apoptosis.
Journal: Adv Sci (Weinh) | Authors: Yingqi Zhang KD Validated | Species: mouse, rat | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
