Mammaglobin A Polyclonal antibody 23501-1-AP proteintech
$149.00
In stock
SKU
23501-1-AP
| Catalog Number | 23501-1-AP |
| Synonyms | SCGB2A2, hMAM, Mammaglobin 1, Mammaglobin1, Mammaglobin-1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, ELISA |
| Applications | IHC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Tested Reactivity | human |
| Cited Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag20122 Product name: Recombinant human SCGB2A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 50-120 aa of BC067220 Sequence: IDDNATTNAIDELKECFLNQTDETLSNVEVFMVISFSSYKLFKSPDQGQVGSSFLTDNAKATSEQAFSYIG Predict reactive species |
| Full Name | secretoglobin, family 2A, member 2 |
| Calculated Molecular Weight | 120 aa, 13 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | BC067220 |
| Gene Symbol | Mammaglobin A |
| Gene ID (NCBI) | 4250 |
| RRID | AB_2879289 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13296 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for Mammaglobin A antibody 23501-1-AP | Download protocol |
| human | WB J Transl Med Machine learning-based identification of kbhb-affected tumor cell subsets as prognostic and therapeutic targets in breast cancer. Authors - Quan Yuan View Article |
| Citations | 2 |
| Dilutions | IHC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa. This polyclonal antibody is raised against the C-terminal 71 amino acids of the protein encoded by a cDNA (MGC:71974; BC067220). Protocols Product Specific Protocols IHC protocol for Mammaglobin A antibody 23501-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Immunolocalization of MMP9 and MMP2 in osteolytic metastasis originating from MDA-MB-231 human breast cancer cells.
Journal: Mol Med Rep | Authors: Bo Liu | Species: human | Application: IHC - Machine learning-based identification of kbhb-affected tumor cell subsets as prognostic and therapeutic targets in breast cancer.
Journal: J Transl Med | Authors: Quan Yuan | Species: human | Application: WB
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
