SCTR Recombinant monoclonal antibody 83675-6-RR proteintech
$149.00
In stock
SKU
83675-6-RR
| Catalog Number | 83675-6-RR |
| Synonyms | 240675E6, SCT R, SCT-R, secretin receptor, SR |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | THP-1 cells, mouse pancreas tissue |
| Tested Applications — Positive IF/ICC detected in | THP-1 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:5000-1:50000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | THP-1 cells, mouse pancreas tissue |
| Positive IF/ICC detected in | THP-1 cells |
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag5371 Product name: Recombinant human SCTR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-142 aa of BC035757 Sequence: QVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKL Predict reactive species |
| Full Name | SCTR |
| Calculated Molecular Weight | 440 aa, 50 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC035757 |
| Gene Symbol | SCTR |
| Gene ID (NCBI) | 6344 |
| RRID | AB_3743487 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purfication |
| UNIPROT ID | P47872 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SCTR antibody 83675-6-RR | Download protocol |
| WB protocol for SCTR antibody 83675-6-RR | Download protocol |
| Citations | - |
| Dilutions | WB : 1:5000-1:50000 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240675E6 |
| Conjugation | Unconjugated |
SCTR is a member of the family B G protein-coupled receptors. SCTR is a receptor for SCT, a gastrointestinal peptide hormone secreted by the S cells of the duodenum. SCT regulates water homeostasis throughout the body and influences the environment of the duodenum by regulating SCT in the stomach and pancreas. Studies suggest that SCT can act as a neuropeptide within the central nervous system (CNS), thus SCTR may regulate the function of the CNS. Protocols Product Specific Protocols IF protocol for SCTR antibody 83675-6-RR Download protocol WB protocol for SCTR antibody 83675-6-RR Download protocol Standard Protocols Click here to view our Standard Protocols
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
