SEC23IP Polyclonal antibody 20892-1-AP proteintech
$149.00
In stock
SKU
20892-1-AP
| Catalog Number | 20892-1-AP |
| Synonyms | MSTP053, p125, SEC23-interacting protein |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, mouse kidney tissue, HeLa cells, U-251 cells |
| Tested Applications — Positive IP detected in | HeLa cells |
| Tested Applications — Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | HeLa cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HEK-293 cells, mouse kidney tissue, HeLa cells, U-251 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag14916 Product name: Recombinant human SEC23IP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 651-1000 aa of BC063800 Sequence: ETLEALSLSEYFSTFEKEKIDMESLLMCTVDDLKEMGIPLGPRKKIANFVEHKAAKLKKAASEKKAVAATSTKGQEQSAQKTKDMASLPSESNEPKRKLPVGACVSSVCVNYESFEVGAGQVSVAYNSLDFEPEIFFALGSPIAMFLTIRGVDRIDENYSLPTCKGFFNIYHPLDPVAYRLEPMIVPDLDLKAVLIPHHKGRKRLHLELKESLSRMGSDLKQGFISSLKSAWQTLNEFARAHTSSTQLQEELEKVANQIKEEEEKQVVEAEKVVESPDFSKDEDYLGKVGMLNGGRRIDYVLQEKPIESFNEYLFALQSHLCYWESEDTALLLLKEIYRTMNISPEQPQH Predict reactive species |
| Full Name | SEC23 interacting protein |
| Calculated Molecular Weight | 1000 aa, 111 kDa |
| Observed Molecular Weight | 125 kDa |
| GenBank Accession Number | BC063800 |
| Gene Symbol | SEC23IP |
| Gene ID (NCBI) | 11196 |
| RRID | AB_10896458 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y6Y8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SEC23IP antibody 20892-1-AP | Download protocol |
| IHC protocol for SEC23IP antibody 20892-1-AP | Download protocol |
| IP protocol for SEC23IP antibody 20892-1-AP | Download protocol |
| WB protocol for SEC23IP antibody 20892-1-AP | Download protocol |
| human | IF J Cell Biol Small GTPase ActIvitY ANalyzing (SAIYAN) system: A method to detect GTPase activation in living cells Authors - Miharu Maeda View Article |
| mouse | WB Nutrients Effects of Freeze-Dried Sake Lees and Rice Koji Extract on Osteoporosis in a Postmenopausal Mouse Model Authors - Jorge Sáez-Chandía View Article |
| Citations | 5 |
| Dilutions | WB : 1:1000-1:4000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:200-1:800 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SEC23-interacting protein (SEC23IP), also known as p125, is a member of the phosphatidic acid preferring-phospholipase A1 family. SEC23IP interacts with Sec23, a coat component of COPII vesicles which are involved in protein export from the endoplasmic reticulum (ER). SEC23IP localizes to ER exit sites and participates in the organization of this compartment (PMID: 15623529). It may have a role in the early stage of the secretory pathway (PMID: 10400679). Protocols Product Specific Protocols IF protocol for SEC23IP antibody 20892-1-AP Download protocol IHC protocol for SEC23IP antibody 20892-1-AP Download protocol IP protocol for SEC23IP antibody 20892-1-AP Download protocol WB protocol for SEC23IP antibody 20892-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Ionic Liquid-Based Extraction System for In-Depth Analysis of Membrane Protein Complexes.
Journal: Anal Chem | Authors: Hongwei Chu | Species: human | Application: WB - Sec23IP recruits VPS13B/COH1 to ER exit site-Golgi interface for tubular ERGIC formation
Journal: J Cell Biol | Authors: Yuanjiao Du KO Validated | Species: human | Application: WB,IF - Effects of Freeze-Dried Sake Lees and Rice Koji Extract on Osteoporosis in a Postmenopausal Mouse Model
Journal: Nutrients | Authors: Jorge Sáez-Chandía | Species: mouse | Application: WB - Small GTPase ActIvitY ANalyzing (SAIYAN) system: A method to detect GTPase activation in living cells
Journal: J Cell Biol | Authors: Miharu Maeda | Species: human | Application: IF - Dynamic O-GlcNAcylation of Sec23-interacting protein regulates COPII function.
Journal: J Biol Chem | Authors: Tetsuya Hirata
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
