SEMA3A Recombinant monoclonal antibody, PBS Only (Capture) 83579-3-PBS proteintech
$699.00
In stock
SKU
83579-3-PBS
| Catalog Number | 83579-3-PBS |
| Synonyms | coll 1, Hsema I, Hsema III, Sema III, SEMA1 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag27173 Product name: Recombinant human SEMA3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 140-235 aa of BC111416 Sequence: ICTYIEIGHHPEDNIFKLENSHFENGRGKSPYDPKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISES Predict reactive species |
| Full Name | sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A |
| Calculated Molecular Weight | 771 aa, 89 kDa |
| GenBank Accession Number | BC111416 |
| Gene Symbol | SEMA3A |
| Gene ID (NCBI) | 10371 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q14563 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240509F11 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
