SETD4 Polyclonal antibody 30855-1-AP proteintech
$149.00
In stock
SKU
30855-1-AP
| Catalog Number | 30855-1-AP |
| Synonyms | C21orf18, C21orf27, SET domain containing 4, SETD 4 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HEK-293 cells, MG-63 cells, U2OS cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:500-1:1000 |
| Positive WB detected in | HEK-293 cells, MG-63 cells, U2OS cells |
| Western Blot (WB) | WB : 1:500-1:1000 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag33842 Product name: Recombinant human SETD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC002898 Sequence: MQKGKGRTSRIRRRKLCGSSESRGVNESHKSEFIELRKWLKARKFQDSNL Predict reactive species |
| Full Name | SET domain containing 4 |
| Calculated Molecular Weight | 440 aa, 50 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC002898 |
| Gene Symbol | SETD4 |
| Gene ID (NCBI) | 54093 |
| RRID | AB_3742378 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9NVD3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for SETD4 antibody 30855-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:500-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
As a lysine methyl-transferase of histone, SET domain-containing protein 4 (SETD4) has been reported to play a role in cell proliferation by controlling related gene expressions . Limited reports reveal that SETD4 is not only indispensable for embryonic neurogenesis, development and regeneration of pancreatic and intestinal organs, regulation of bone marrow mesenchymal stem cells, and modulation of inflammatory cytokines of macrophages, but also involved in the tumorigenesis, progression, and chemotherapy resistance of various tumors, including liver cancer, breast cancer, lymphoma and Non-small Cell Lung Cancer. (PMID: 35545041, PMID: 36027907, PMID: 37879429) Protocols Product Specific Protocols WB protocol for SETD4 antibody 30855-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
