SIAH1 Recombinant monoclonal antibody, PBS Only (Capture) 83389-2-PBS proteintech
$699.00
In stock
SKU
83389-2-PBS
| Catalog Number | 83389-2-PBS |
| Synonyms | E3 ubiquitin-protein ligase SIAH1, EC:2.3.2.27, RING-type E3 ubiquitin transferase SIAH1, Siah-1, Siah-1a |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag34618 Product name: Recombinant human SIAH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC035562 Sequence: MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLP Predict reactive species |
| Full Name | seven in absentia homolog 1 (Drosophila) |
| Calculated Molecular Weight | 282 aa, 31 kDa |
| GenBank Accession Number | BC035562 |
| Gene Symbol | SIAH1 |
| Gene ID (NCBI) | 6477 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8IUQ4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240377H7 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
