SIRT6 Polyclonal antibody 28677-1-AP proteintech
$149.00
In stock
SKU
28677-1-AP
| Catalog Number | 28677-1-AP |
| Synonyms | EC:2.3.1.-, EC:2.3.1.286, EC:2.4.2.-, hSIRT6, NAD-dependent protein deacetylase sirtuin-6 |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, CoIP, ELISA |
| Applications | WB, IHC, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, PC-3 cells |
| Tested Applications — Positive IHC detected in | human placenta tissue, mouse liver tissue, mouse stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Tested Applications — Positive IF/ICC detected in | SH-SY5Y cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:6000 |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, PC-3 cells |
| Positive IHC detected in | human placenta tissue, mouse liver tissue, mouse stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag29163 Product name: Recombinant human SIRT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-328 aa of BC028220 Sequence: ATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS Predict reactive species |
| Full Name | sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae) |
| Calculated Molecular Weight | 39 kDa |
| Observed Molecular Weight | 39 kDa |
| GenBank Accession Number | BC028220 |
| Gene Symbol | SIRT6 |
| Gene ID (NCBI) | 51548 |
| RRID | AB_3669666 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N6T7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for SIRT6 antibody 28677-1-AP | Download protocol |
| IHC protocol for SIRT6 antibody 28677-1-AP | Download protocol |
| WB protocol for SIRT6 antibody 28677-1-AP | Download protocol |
| mouse | IHC,IF Adv Healthc Mater Remodeling Cellular Uptake via Inducing Clustering of Urokinase Receptors in Hydrogel Microspheres for Alleviating Cartilage Senescence. Authors - Zhiqi Lin View Article |
| human | IHC Mol Cell Biochem Squalene attenuates doxorubicin resistance in hepatocellular carcinoma by targeting SIRT6 to inhibit ERK1 deacetylation. Authors - Geqiong Xiao View Article |
| Citations | 3 |
| Dilutions | WB : 1:1000-1:6000 IHC : 1:250-1:1000 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
The SIRT6 gene is located at chromosome 19p13.3 and contains 8 exons. The encoded protein has a total length of 355 amino acids. SIRT6 protein is a member of the Sirtuins, which is a class of NAD+-dependent protein deacetylases involved in stress resistance and metabolic homeostasis. SIRT6 also plays roles in various tumors as both an oncogene and tumor suppressor gene. A previous study in osteosarcoma reported that SIRT6 regulates the migration and invasion of tumors through the ERK1/2/MMP9 pathway. (PMID: 30675128) Protocols Product Specific Protocols IF protocol for SIRT6 antibody 28677-1-AP Download protocol IHC protocol for SIRT6 antibody 28677-1-AP Download protocol WB protocol for SIRT6 antibody 28677-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Translocation of SIRT6 promotes glycolysis reprogramming to exacerbate diabetic angiopathy.
Journal: Redox Biol | Authors: Kemiao Pang | Application: IF,CoIP - Remodeling Cellular Uptake via Inducing Clustering of Urokinase Receptors in Hydrogel Microspheres for Alleviating Cartilage Senescence.
Journal: Adv Healthc Mater | Authors: Zhiqi Lin | Species: mouse | Application: IHC,IF - Squalene attenuates doxorubicin resistance in hepatocellular carcinoma by targeting SIRT6 to inhibit ERK1 deacetylation.
Journal: Mol Cell Biochem | Authors: Geqiong Xiao | Species: human | Application: IHC
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
