SLC17A6 Recombinant monoclonal antibody, PBS Only (Capture) 84083-1-PBS proteintech
$699.00
In stock
SKU
84083-1-PBS
| Catalog Number | 84083-1-PBS |
| Synonyms | PBS Only |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag29565 Product name: Recombinant human SLC17A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 499-582 aa of NM_020346 Sequence: SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS Predict reactive species |
| Full Name | solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 |
| Calculated Molecular Weight | 64 kDa |
| GenBank Accession Number | NM_020346 |
| Gene Symbol | VGLUT2 |
| Gene ID (NCBI) | 57084 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9P2U8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241255A2 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
