SLC1A4 Polyclonal antibody 13067-2-AP proteintech
$149.00
In stock
SKU
13067-2-AP
| Catalog Number | 13067-2-AP |
| Synonyms | ASCT1, ASCT-1, SATT |
| Host | Rabbit |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF, IP, ELISA |
| Applications | WB, IHC, IP, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | Raji cells, mouse brain tissue, human skeletal muscle tissue, SW480 cells, mouse kidney tissue, rat brain tissue |
| Tested Applications — Positive IP detected in | mouse brain tissue |
| Tested Applications — Positive IHC detected in | mouse kidney tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:10000 |
| Recommended Dilutions — Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Recommended Dilutions — Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Positive WB detected in | Raji cells, mouse brain tissue, human skeletal muscle tissue, SW480 cells, mouse kidney tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse kidney tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag3763 Product name: Recombinant human SLC1A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 431-532 aa of BC026216 Sequence: IAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL Predict reactive species |
| Full Name | solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 |
| Calculated Molecular Weight | 532 aa, 56 kDa |
| Observed Molecular Weight | 62-70 kDa |
| GenBank Accession Number | BC026216 |
| Gene Symbol | SLC1A4 |
| Gene ID (NCBI) | 6509 |
| RRID | AB_2190604 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P43007 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IHC protocol for SLC1A4 antibody 13067-2-AP | Download protocol |
| IP protocol for SLC1A4 antibody 13067-2-AP | Download protocol |
| WB protocol for SLC1A4 antibody 13067-2-AP | Download protocol |
| mouse | WB Mamm Genome Generation and characterization of a knock-in mouse model for spastic tetraplegia, thin corpus callosum, and progressive microcephaly (SPATCCM) Authors - Megan L Ratz-Mitchem KO Validated View Article |
| human | WB Front Oncol SLC1A4: A Powerful Prognostic Marker and Promising Therapeutic Target for HCC. Authors - Xiaozhen Peng View Article |
| Amy (Verified Customer) (02-06-2026) | Great, works well. Applications: Western Blot Primary Antibody Dilution: 1:1000 Cell Tissue Type: Mammary gland tumour cells |
| Citations | 13 |
| Dilutions | WB : 1:2000-1:10000 IP : 0.5-4.0 ug for IP and 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate for WB IHC : 1:250-1:1000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
Publications
- Transcriptional regulation by PHGDH drives amyloid pathology in Alzheimer's disease
Journal: Cell | Authors: Junchen Chen | Species: mouse | Application: IF - CircMYH9 drives colorectal cancer growth by regulating serine metabolism and redox homeostasis in a p53-dependent manner
Journal: Mol Cancer | Authors: Xin Liu | Species: human | Application: WB - Toxic effects of maternal cadmium exposure on the metabolism and transport system of amino acids in the maternal livers
Journal: Ecotoxicol Environ Saf | Authors: Peng Xu | Species: mouse | Application: WB - SLC1A4: A Powerful Prognostic Marker and Promising Therapeutic Target for HCC.
Journal: Front Oncol | Authors: Xiaozhen Peng | Species: human | Application: WB - Generation and characterization of a knock-in mouse model for Spastic Tetraplegia, Thin Corpus Callosum, and Progressive Microcephaly (SPATCCM)
Journal: Res Sq | Authors: Megan L Ratz | Species: mouse | Application: WB
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
