SLC22A4 Recombinant monoclonal antibody, PBS Only (Capture) 83192-2-PBS proteintech
$699.00
In stock
SKU
83192-2-PBS
| Catalog Number | 83192-2-PBS |
| Synonyms | ETT, ETTh, OCTN1, UT2H |
| Host | Rabbit |
| Reactivity | human, mouse |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human, mouse |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag3974 Product name: Recombinant human SLC22A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-142 aa of BC028313 Sequence: NGFNGMSVVFLAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWKV Predict reactive species |
| Full Name | solute carrier family 22 (organic cation/ergothioneine transporter), member 4 |
| Calculated Molecular Weight | 551 aa, 62 kDa |
| GenBank Accession Number | BC028313 |
| Gene Symbol | SLC22A4 |
| Gene ID (NCBI) | 6583 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9H015 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240064F6 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
