SLC24A2 Recombinant monoclonal antibody, PBS Only (Capture/Detector) 83529-2-PBS proteintech
$699.00
In stock
SKU
83529-2-PBS
| Catalog Number | 83529-2-PBS |
| Synonyms | PBS Only |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Applications | Cytometric bead array, Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag35294 Product name: Recombinant human SLC24A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-132 aa of NM_020344 Sequence: SETDTQSTGEASVVSGPRVAQGYHQRTLLDLNDKILDYTPQPPLSKEGESENSTDHAQGDYPKDIFSLEERRK Predict reactive species |
| Full Name | solute carrier family 24 (sodium/potassium/calcium exchanger), member 2 |
| Calculated Molecular Weight | 661 aa, 74 kDa |
| GenBank Accession Number | NM_020344 |
| Gene Symbol | SLC24A2 |
| Gene ID (NCBI) | 25769 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9UI40 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240467F8 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
