SLC25A36 Monoclonal antibody, PBS Only 67896-1-PBS proteintech
$699.00
In stock
SKU
67896-1-PBS
| Catalog Number | 67896-1-PBS |
| Synonyms | Solute carrier family 25 member 36, 1E5E4 |
| Host | Mouse |
| Reactivity | human, mouse, rat |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | WB, IHC, IF/ICC, Indirect ELISA |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | human, mouse, rat |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag23894 Product name: Recombinant human SLC25A36 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 97-184 aa of BC014064 Sequence: IYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASY Predict reactive species |
| Full Name | solute carrier family 25, member 36 |
| GenBank Accession Number | BC014064 |
| Gene Symbol | SLC25A36 |
| Gene ID (NCBI) | 55186 |
| RRID | AB_2918652 |
| Conjugate | Unconjugated |
| Purification Method | Protein G purification |
| UNIPROT ID | Q96CQ1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1E5E4 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
