SLC31A1 Recombinant monoclonal antibody, PBS Only 83844-3-PBS proteintech
$699.00
In stock
SKU
83844-3-PBS
| Catalog Number | 83844-3-PBS |
| Synonyms | COPT1, CTR1, Truncated CTR1 form |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag26601 Product name: Recombinant human SLC31A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species |
| Full Name | solute carrier family 31 (copper transporters), member 1 |
| Calculated Molecular Weight | 21 kDa |
| GenBank Accession Number | BC013611 |
| Gene Symbol | SLC31A1 |
| Gene ID (NCBI) | 1317 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | O15431 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240868C2 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
