TNF-alpha Polyclonal antibody 17590-1-AP proteintech
$149.00
In stock
SKU
17590-1-AP
| Catalog Number | 17590-1-AP |
| Synonyms | TNF, TNF alpha, TNF-a, C-domain 1, C-domain 2 |
| Host | Rabbit |
| Reactivity | human, mouse and More (6) |
| Reactivity | human, mouse, rat, pig, rabbit, bovine, sheep, fish |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, IHC, IF/ICC, ELISA, Cell treatment, Transwell Assay |
| Applications | WB, IF/ICC, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | PMA, LPS and Brefeldin A treated THP-1 cells, LPS treated RAW 264.7 cells |
| Tested Applications — Positive IF/ICC detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:1000-1:4000 |
| Recommended Dilutions — Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Positive WB detected in | PMA, LPS and Brefeldin A treated THP-1 cells, LPS treated RAW 264.7 cells |
| Positive IF/ICC detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, rabbit, bovine, sheep, fish |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag11433 Product name: Recombinant human TNF-a protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-233 aa of BC028148 Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL Predict reactive species |
| Full Name | tumor necrosis factor (TNF superfamily, member 2) |
| Calculated Molecular Weight | 233 aa, 26 kDa |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | BC028148 |
| Gene Symbol | TNF-alpha |
| Gene ID (NCBI) | 7124 |
| ENSEMBL Gene ID | ENSG00000232810 |
| RRID | AB_2271853 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01375 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| IF protocol for TNF-alpha antibody 17590-1-AP | Download protocol |
| WB protocol for TNF-alpha antibody 17590-1-AP | Download protocol |
| human | WB Exploration (Beijing) Targeting eEF1A1 With Baicalein to Block eEF1A1/Prdx4 Interaction for Treating Sepsis-Mediated Lung Injury Authors - Jing Chang View Article |
| mouse | WB Adv Mater Unlocking an Efficient SOD-to-CAT Catalytic Relay in a MOF Nanozyme via Dopamine-Driven Interfacial Nanoreconstruction for Osteoarthritis Therapy. Authors - Zhiqiang Li View Article |
| mouse,human | WB,IF Adv Mater Membrane Fusion-Mediated Loading of Therapeutic siRNA into Exosome for Tissue-Specific Application Authors - Miao Xie View Article |
| rat,mouse | WB Adv Mater Dual Single-Atom Engineered NADH Oxidase-Mimic Boosts In Situ NAD(+) Biotransformation for Targeted Myocardial Ischemia/Reperfusion Protection. Authors - Jingtao Liu View Article |
| YINGJIAN (Verified Customer) (11-15-2025) | The antibody produced clear signals with negligible background and high target specificity. Applications: Western Blot, Immunohistochemistry Primary Antibody Dilution: WB: 1:2000 IHC (paraffin)：1：500 Cell Tissue Type: liver |
| Margarita (Verified Customer) (11-22-2023) | Prostate Cancer cell line, overnight incubation, Mouse Applications: Immunofluorescence Primary Antibody Dilution: 1:100 Cell Tissue Type: TRAMPC C2 TNF-alpha Antibody Immunofluorescence validation (1:100 dilution) in TRAMPC C2 (Cat no:17590-1-AP) |
| Isha (Verified Customer) (09-20-2021) | signal was very good. My sample was renal tissue lysate after ischemia reperfusion Applications: Western Blot Primary Antibody Dilution: 1:800 Cell Tissue Type: Kidney |
| Citations | 1233 |
| Dilutions | WB : 1:1000-1:4000 IF/ICC : 1:50-1:500 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, ins resistance, and cancer. Protocols Product Specific Protocols IF protocol for TNF-alpha antibody 17590-1-AP Download protocol WB protocol for TNF-alpha antibody 17590-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Publications
- Targeting eEF1A1 With Baicalein to Block eEF1A1/Prdx4 Interaction for Treating Sepsis-Mediated Lung Injury
Journal: Exploration (Beijing) | Authors: Jing Chang | Species: human | Application: WB - Microglial targeted therapy relieves cognitive impairment caused by Cntnap4 deficiency
Journal: Exploration (Beijing) | Authors: Wenlong Zhang | Species: mouse | Application: WB - Membrane Fusion-Mediated Loading of Therapeutic siRNA into Exosome for Tissue-Specific Application
Journal: Adv Mater | Authors: Miao Xie | Species: mouse,human | Application: WB,IF - Dual Single-Atom Engineered NADH Oxidase-Mimic Boosts In Situ NAD(+) Biotransformation for Targeted Myocardial Ischemia/Reperfusion Protection.
Journal: Adv Mater | Authors: Jingtao Liu | Species: rat,mouse | Application: WB - Unlocking an Efficient SOD-to-CAT Catalytic Relay in a MOF Nanozyme via Dopamine-Driven Interfacial Nanoreconstruction for Osteoarthritis Therapy.
Journal: Adv Mater | Authors: Zhiqiang Li | Species: mouse | Application: WB - Polymer-Zn(II) sunscreens for protection against harmful blue ray.
Journal: Bioact Mater | Authors: Rui Yuan - Nano MgO loaded thermosensitive HPCH@HA hydrogel accelerates in situ bone repair through osteoimmunomodulation while enhancing angiogenesis and osteogenesis.
Journal: Bioact Mater | Authors: Feifei Ni | Species: mouse | Application: IHC - Multifunctional hydrogel encapsulated with baicalin for full-layer regeneration of drug-resistant bacteria-infected wounds after radiotherapy
Journal: Bioact Mater | Authors: Rui Yuan | Species: mouse | Application: IHC - Immunomodulatory copper-based polyphenol nanozyme for diabetic infectious wound healing via NIR amplified cuproptosis bacteriostat in synergy with ferroptosis inhibition anti-inflammation.
Journal: Bioact Mater | Authors: Huyang Gao | Species: mouse | Application: IF - Bioengineered platelet nanoplatform enables renal-targeted dexamethasone delivery for chronic nephritis therapy with dual anti-inflammatory/anti-fibrotic effects and minimized systemic toxicity
Journal: Bioact Mater | Authors: Lingling Zhang | Application: WB - An astragalus polysaccharide-loaded hydrogel dressing enhances diabetic wound healing via dual-mode electrical stimulation.
Journal: Bioact Mater | Authors: Zheng Chen | Species: human | Application: WB - A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds
Journal: Bioact Mater | Authors: Shunlai Shang | Species: mouse | Application: IHC - Near infrared enhanced palladium loaded siraitia grosvenorii carbon dots amplify mitophagy for acute lung injury immunotherapy.
Journal: Bioact Mater | Authors: Jing Zhang - TRAF7 protects against acute lung injury by promoting K6-linked ubiquitination of AKT
Journal: Sci Bull (Beijing) | Authors: Jia Wang | Species: human | Application: WB - Omentin-1 prevents inflammation-induced osteoporosis by downregulating the pro-inflammatory cytokines.
Journal: Bone Res | Authors: Shan-Shan Rao | Species: mouse | Application: IHC - Near-infrared light-driven nanomotors-based microneedles for the active therapy of bacterial infected acne.
Journal: Nat Commun | Authors: Ziwei Hu | Species: mouse | Application: IHC - Porous microneedle patch with sustained delivery of extracellular vesicles mitigates severe spinal cord injury
Journal: Nat Commun | Authors: Ao Fang | Application: WB - Tenascin C(+) myofibroblasts exacerbate vascular neointimal hyperplasia by propagation of nerve-macrophage interactions in mice.
Journal: Nat Commun | Authors: Xinran Tong | Species: mouse | Application: IF - Circulating extracellular vesicle microRNAs mediate immune modulation of social behavior in male mice.
Journal: Nat Commun | Authors: Ken Matoba | Species: mouse | Application: WB - Fibroblast derived C3 promotes the progression of experimental periodontitis through macrophage M1 polarization and osteoclast differentiation
Journal: Int J Oral Sci | Authors: Feilong Ren | Species: mouse | Application: IHC - Multifunctional Injectable Bioadhesive with Toll-like Receptor 4 and Myeloid Differentiation Factor 2 Antagonistic Anti-inflammatory Potential for Periodontal Regeneration
Journal: ACS Nano | Authors: Shuting Gao | Species: rat | Application: IHC - Engineered Therapeutic Bacteria with High-Yield Membrane Vesicle Production Inspired by Eukaryotic Membrane Curvature for Treating Inflammatory Bowel Disease
Journal: ACS Nano | Authors: Jinjin Chen | Species: mouse | Application: IHC - Chemical Gambit in Bone Microenvironment: pH-Responsive Cu-Mn Nanoplatform Breaks the Inflammation-Osteoclast Vicious Cycle in Prosthesis-Associated Osteolysis.
Journal: ACS Nano | Authors: Minghao Jin | Species: mouse | Application: IHC - Vitamin A-Integrated Cinnamaldehyde Nanoemulsion: A Nanotherapeutic Approach To Counteract Liver Fibrosis via Gut-Liver Axis Modulation
Journal: ACS Nano | Authors: Xia Niu | Species: rat | Application: IF - PERK drives aflatoxin B1-induced chicken cellular senescence by promoting NLRP3-mediated PANoptosis.
Journal: J Adv Res | Authors: Yue Cheng | Application: WB - Endogenous hydrogen sulfide improves vascular remodeling through PPARδ/SOCS3 signaling.
Journal: J Adv Res | Authors: Danyang Tian | Species: mouse | Application: WB - Luteolin as a novel therapeutic for diabetic kidney disease: Targeting the ADAM10-TREM2 pathway.
Journal: J Adv Res | Authors: Lingchen Deng | Species: mouse | Application: WB - Setmelanotide alleviates diabetes-associated cognitive impairment by interrupting the binding of ICAM-1 and JIP1 in endothelial cells of the blood-brain barrier.
Journal: Metabolism | Authors: Shi-Di Wu - Icariin alleviates uveitis by targeting peroxiredoxin 3 to modulate retinal microglia M1/M2 phenotypic polarization.
Journal: Redox Biol | Authors: Guoqing Wang | Species: mouse | Application: WB - Histone H3K9 lactylation activates the TXNIP/NLRP3 pathway to drive macrophage inflammation after spinal cord injury.
Journal: Redox Biol | Authors: Chaoran Shi | Species: mouse | Application: WB - Histone H3K9 lactylation activates the TXNIP/NLRP3 pathway to drive macrophage inflammation after spinal cord injury.
Journal: Redox Biol | Authors: Chaoran Shi | Species: mouse | Application: WB - Icariin alleviates uveitis by targeting peroxiredoxin 3 to modulate retinal microglia M1/M2 phenotypic polarization.
Journal: Redox Biol | Authors: Guoqing Wang | Species: mouse | Application: WB - PUFAs add fuel to Crohn's disease-associated AIEC-induced enteritis by exacerbating intestinal epithelial lipid peroxidation
Journal: Gut Microbes | Authors: Weiwei Wen | Species: mouse | Application: IHC - S-amlodipine induces liver inflammation and dysfunction through the alteration of intestinal microbiome in a rat model
Journal: Gut Microbes | Authors: Xinxin Liu | Species: rat | Application: WB - Dysregulation of gut microbiota stimulates NETs-driven HCC intrahepatic metastasis: therapeutic implications of healthy faecal microbiota transplantation
Journal: Gut Microbes | Authors: Zhe Deng | Species: mouse | Application: WB,IHC - Rescue of nucleus pulposus cells from an oxidative stress microenvironment via glutathione-derived carbon dots to alleviate intervertebral disc degeneration
Journal: J Nanobiotechnology | Authors: Wenzhen Bu | Species: rat | Application: IF - MXene-integrated microneedles reprogram diabetic-associated macrophages for deep-wound infection therapy and immunoprotection.
Journal: J Nanobiotechnology | Authors: Wenshuai Li | Species: mouse | Application: IF - Mesoporous Prussian blue nanoparticle neuroconduit for the biological therapy targeting oxidative stress reduction, inflammation inhibition, and nerve regeneration
Journal: J Nanobiotechnology | Authors: Junyi Zhu | Species: mouse | Application: IF - Microneedle patches deliver targeted GLP-1RAs-loaded nanoparticles for the treatment of rheumatoid arthritis.
Journal: J Nanobiotechnology | Authors: Hongyu Zhang | Species: rat | Application: WB,IHC,IF - Modification of transvaginal polypropylene mesh with co-axis electrospun nanofibrous membrane to alleviate complications following surgical implantation
Journal: J Nanobiotechnology | Authors: Tao Guo | Species: rat | Application: IHC - Targeting JAK2 with a multifunctional nanoinhibitor for long-lasting anti-inflammatory effects and bone repair.
Journal: J Nanobiotechnology | Authors: Yang Liu | Species: mouse | Application: WB - Palladium nanozyme loaded metal-organic framework eyedrops alleviate oxidative stress for dry eye treatment.
Journal: J Nanobiotechnology | Authors: Yajia Wang | Species: mouse | Application: IF - Neutrophil N1 polarization induced by cardiomyocyte-derived extracellular vesicle miR-9-5p aggravates myocardial ischemia/reperfusion injury
Journal: J Nanobiotechnology | Authors: Yeshen Zhang | Species: mouse | Application: WB - Targeting JAK2 with a multifunctional nanoinhibitor for long-lasting anti-inflammatory effects and bone repair.
Journal: J Nanobiotechnology | Authors: Yang Liu | Species: mouse | Application: WB - Tetrasulfide-bridged virus-like particles enable host-sparing cascade membrane-metabolic disruption for drug-resistant bacterial keratitis.
Journal: J Nanobiotechnology | Authors: Wenlong Li - Single-atom Ca nanozyme induces glioma death through Ca(2+)-overload-enhanced catalytic tumor nanotherapy, ferroptosis and synergistic remodeling of the immune microenvironment.
Journal: J Nanobiotechnology | Authors: Zhizhong Jin | Species: human | Application: WB - Palladium nanozyme loaded metal-organic framework eyedrops alleviate oxidative stress for dry eye treatment.
Journal: J Nanobiotechnology | Authors: Yajia Wang | Species: mouse | Application: IF - Anti-inflammatory and immunomodulatory effects of the extracellular vesicles derived from human umbilical cord mesenchymal stem cells on osteoarthritis via M2 macrophages.
Journal: J Nanobiotechnology | Authors: Kanglu Li | Application: WB - Bioinspired exosome-SiO2 nanohybrid therapeutic for rheumatoid arthritis treatment
Journal: Theranostics | Authors: Qicui Zhu | Species: mouse | Application: IF - The role of an ultrasound-responsive injectable piezoelectric hydrogel in promoting nerve regeneration and alleviating neuropathic pain.
Journal: Theranostics | Authors: Zhaoyang Guo | Species: rat | Application: WB - Methyl-CpG-binding 2 K271 lactylation-mediated M2 macrophage polarization inhibits atherosclerosis
Journal: Theranostics | Authors: Liangqi Chen | Species: mouse | Application: WB - Vagal innervation limits brain injury by inhibiting gut-selective integrin-mediated intestinal immunocyte migration in intracerebral hemorrhage
Journal: Theranostics | Authors: Peiji Fu | Species: mouse | Application: WB - Dissolvable microneedles loaded with denosumab alleviate knee osteoarthritis in rodent and canine models by inhibiting macrophage senescence.
Journal: Theranostics | Authors: Chaochang Ming | Species: mouse | Application: WB,IHC - S100A9 as a potential novel target for experimental autoimmune cystitis and interstitial cystitis/bladder pain syndrome
Journal: Biomark Res | Authors: Jiang Zhao | Species: mouse | Application: WB - HBP1-mediated transcriptional repression of AFP inhibits hepatoma progression.
Journal: J Exp Clin Cancer Res | Authors: Zhengyi Cao | Species: human | Application: WB - Huachansu suppresses human bladder cancer cell growth through the Fas/Fasl and TNF- alpha/TNFR1 pathway in vitro and in vivo.
Journal: J Exp Clin Cancer Res | Authors: Tao Yang | Species: mouse | Application: IHC - H(2)S-Releasing Aspirin Nanoparticles Alleviate Endometriosis and Associated Anxiety.
Journal: Adv Sci (Weinh) | Authors: Mengni Zhou | Species: mouse | Application: IF - Engineering Efferocytosis-Mimicking Nanovesicles to Regulate Joint Anti-Inflammation and Peripheral Immunosuppression for Rheumatoid Arthritis Therapy.
Journal: Adv Sci (Weinh) | Authors: Shanshan Yuan | Species: mouse | Application: IHC - CD44-Targeting Hydroxyapatite Nanoparticles (HAP) Induce Mitochondrial Dysfunction-Driven PANoptosis and Immunogenic Cell Death (ICD) via Ca Overload in Colorectal Cancer.
Journal: Adv Sci (Weinh) | Authors: Yao Xiao | Species: mouse | Application: WB - Intermittent Fasting Targets Osteocyte Neuropeptide Y to Relieve Osteoarthritis
Journal: Adv Sci (Weinh) | Authors: Yu-Xuan Qian | Species: mouse | Application: IHC - The KDM6B/SLC10A2 Axis Suppresses MDSCs Recruitment via ERK/AP-1 Signaling in Colorectal Cancer.
Journal: Adv Sci (Weinh) | Authors: Zhibo Hu | Species: mouse | Application: WB - Engineering Efferocytosis-Mimicking Nanovesicles to Regulate Joint Anti-Inflammation and Peripheral Immunosuppression for Rheumatoid Arthritis Therapy.
Journal: Adv Sci (Weinh) | Authors: Shanshan Yuan | Species: mouse | Application: IHC - 3D Printing of a Vascularized Mini-Liver Based on the Size-Dependent Functional Enhancements of Cell Spheroids for Rescue of Liver Failure
Journal: Adv Sci (Weinh) | Authors: Jiabin Zhang | Species: mouse | Application: WB - Intermittent Fasting Targets Osteocyte Neuropeptide Y to Relieve Osteoarthritis
Journal: Adv Sci (Weinh) | Authors: Yu-Xuan Qian | Species: mouse | Application: IHC - Prophylactic Supplementation with Lactobacillus Reuteri or Its Metabolite GABA Protects Against Acute Ischemic Cardiac Injury
Journal: Adv Sci (Weinh) | Authors: Jiawan Wang | Species: mouse | Application: IHC - Inhalable ROS-Responsive Nanospray Activates PPAR-γ to Restore Macrophage Mitochondrial Homeostasis and Attenuate Radiation-Induced Lung Injury.
Journal: Adv Sci (Weinh) | Authors: Mingquan Gao | Species: mouse | Application: WB,IF - Copper-Doped Prussian Blue Nanozymes With Hyaluronic Acid-Mediated Targeting Alleviate Oxidative Stress and Regulate Cholesterol Handling for Atherosclerosis Therapy.
Journal: Adv Sci (Weinh) | Authors: Jianliang Ou - 3D Printing of a Vascularized Mini-Liver Based on the Size-Dependent Functional Enhancements of Cell Spheroids for Rescue of Liver Failure
Journal: Adv Sci (Weinh) | Authors: Jiabin Zhang | Species: mouse | Application: WB - CD44-Targeting Hydroxyapatite Nanoparticles (HAP) Induce Mitochondrial Dysfunction-Driven PANoptosis and Immunogenic Cell Death (ICD) via Ca Overload in Colorectal Cancer.
Journal: Adv Sci (Weinh) | Authors: Yao Xiao | Species: mouse | Application: WB - The KDM6B/SLC10A2 Axis Suppresses MDSCs Recruitment via ERK/AP-1 Signaling in Colorectal Cancer.
Journal: Adv Sci (Weinh) | Authors: Zhibo Hu | Species: mouse | Application: WB - LIFUS-driven engineered bacteria reprogram immunosuppressive niches via mechano-NOTCH signaling.
Journal: Cell Rep Med | Authors: Lizhou Lin | Species: mouse | Application: ELISA - Citrulline regulates macrophage metabolism and inflammation to counter aging in mice
Journal: Sci Adv | Authors: Zhangdan Xie | Species: mouse | Application: WB - Magnesium hexacyanoferrate mitigates sepsis-associated encephalopathy through inhibiting microglial activation and neuronal cuproptosis
Journal: Biomaterials | Authors: Yabing Zhang | Species: mouse | Application: WB - A proton-gated gold nanocluster platform for disrupting biofilm bioenergetics and suppressing virulence in bacterial infections.
Journal: Biomaterials | Authors: Jia Liu | Species: rat | Application: IF - Innovative DNA tetrahedron inspired by ancient mortise-and-tenon technique offers new immunotherapy strategy for metastatic breast cancer
Journal: Biomaterials | Authors: Nan Zhang | Species: mouse | Application: WB - Molybdenum nanodots reprogram inflammatory-driven osteolysis via bone immune remodeling.
Journal: Biomaterials | Authors: Zi Fu | Species: mouse | Application: IF - Phase-adapted metal ion supply for spinal cord repair with a Mg-Zn incorporated chimeric microsphere
Journal: Biomaterials | Authors: Xiangyu Liu | Species: mouse | Application: IF - HDAC1-overexpressing dermal papilla cell-derived extracellular vesicles modulate p53 and Wnt/β-catenin signaling to rescue hair follicle regeneration in androgenetic alopecia.
Journal: Biomaterials | Authors: Yulin Sun | Species: mouse | Application: IF - Innovative DNA tetrahedron inspired by ancient mortise-and-tenon technique offers new immunotherapy strategy for metastatic breast cancer
Journal: Biomaterials | Authors: Nan Zhang | Species: mouse | Application: WB - HDAC1-overexpressing dermal papilla cell-derived extracellular vesicles modulate p53 and Wnt/β-catenin signaling to rescue hair follicle regeneration in androgenetic alopecia.
Journal: Biomaterials | Authors: Yulin Sun | Species: mouse | Application: IF - Chitosan/rutin multifunctional hydrogel with tunable adhesion, anti-inflammatory and antibacterial properties for skin wound healing
Journal: Carbohydr Polym | Authors: Ran An | Species: mouse | Application: IF - Carboxymethyl chitosan and sodium alginate oxide pH-sensitive dual-release hydrogel for diabetes wound healing: The combination of astilbin liposomes and diclofenac sodium
Journal: Carbohydr Polym | Authors: Xiaoyu Wu | Species: mouse | Application: WB - Carbohydrate polymer-stabilized Pickering emulsion gel coordinates antimicrobial and pro-regenerative cues for scar-minimized wound healing.
Journal: Carbohydr Polym | Authors: Mubarak G. Bello - Nanohybrid dual-network chitosan-based hydrogels: Synthesis, characterization, quicken infected wound healing by angiogenesis and immune-microenvironment regulation
Journal: Carbohydr Polym | Authors: Yifan Liu | Species: rat | Application: IF - Chitosan/rutin multifunctional hydrogel with tunable adhesion, anti-inflammatory and antibacterial properties for skin wound healing
Journal: Carbohydr Polym | Authors: Ran An | Species: mouse | Application: IF - Nanohybrid dual-network chitosan-based hydrogels: Synthesis, characterization, quicken infected wound healing by angiogenesis and immune-microenvironment regulation
Journal: Carbohydr Polym | Authors: Yifan Liu | Species: rat | Application: IF - Perfluorohexane/hemoglobin nano-oxygen carriers enhance transplanted islet graft survival via hypoxia alleviation and mitochondrial repair.
Journal: J Control Release | Authors: Di Huang | Species: mouse | Application: WB, IHC, IF - Infiltrating peripheral monocyte TREM-1 mediates dopaminergic neuron injury in substantia nigra of Parkinson's disease model mice
Journal: Cell Death Dis | Authors: Wei Song | Species: mouse | Application: WB - Cyclo-(Phe-Tyr) as a novel cyclic dipeptide compound alleviates ischemic/reperfusion brain injury via JUNB/JNK/NF-κB and SOX5/PI3K/AKT pathways.
Journal: Pharmacol Res | Authors: Jiale Cai | Species: rat,mouse | Application: WB - TRPV4-induced inflammatory response is involved in neuronal death in pilocarpine model of temporal lobe epilepsy in mice.
Journal: Cell Death Dis | Authors: Zhouqing Wang | Species: mouse | Application: WB - Cyclo-(Phe-Tyr) as a novel cyclic dipeptide compound alleviates ischemic/reperfusion brain injury via JUNB/JNK/NF-κB and SOX5/PI3K/AKT pathways.
Journal: Pharmacol Res | Authors: Jiale Cai | Species: rat,mouse | Application: WB - Dual-Drug Nanomedicine Assembly with Synergistic Anti-Aneurysmal Effects via Inflammation Suppression and Extracellular Matrix Stabilization
Journal: Small | Authors: Hong Lin Zu | Species: rat | Application: IHC - Bioactive Peptide Hydrogel Scaffold with High Fluidity, Thermosensitivity, and Neurotropism in 3D Spatial Structure for Promoted Repair of Spinal Cord Injury
Journal: Small | Authors: Zhengang Sun | Species: rat | Application: IF - M2 Macrophage Membrane-Mediated Biomimetic-Nanoparticle Carrying COX-siRNA Targeted Delivery for Prevention of Tendon Adhesions by Inhibiting Inflammation
Journal: Small | Authors: Jie Sun | Application: WB,IF - Macrophage contributes to radiation-induced anti-tumor abscopal effect on transplanted breast cancer by HMGB1/TNF-α signaling factors.
Journal: Int J Biol Sci | Authors: Lin Zhu | Species: human | Application: WB - Integrated single-cell transcriptomics and proteomics elucidate the molecular mechanisms and detoxification strategy of rifampicin-induced hepatotoxicity.
Journal: Int J Biol Sci | Authors: Junhui Chen | Species: mouse | Application: WB - Integrated single-cell transcriptomics and proteomics elucidate the molecular mechanisms and detoxification strategy of rifampicin-induced hepatotoxicity.
Journal: Int J Biol Sci | Authors: Junhui Chen | Species: mouse | Application: WB - MiR-124 Negatively Regulated PARP1 to Alleviate Renal Ischemia-reperfusion Injury by Inhibiting TNFα/RIP1/RIP3 Pathway.
Journal: Int J Biol Sci | Authors: Jing Ke | Species: human | Application: WB - Mechanistic study of celastrol-mediated inhibition of proinflammatory activation of macrophages in IgA nephropathy via down-regulating ECM1
Journal: Int J Biol Sci | Authors: Juanyong Zhao | Species: mouse | Application: WB - Rationalized inhibition of mixed lineage kinase 3 and CD70 enhances life span and antitumor efficacy of CD8+ T cells.
Journal: J Immunother Cancer | Authors: Sandeep Kumar | Species: mouse | Application: IHC,IF - Knockdown of trem2 promotes proinflammatory microglia and inhibits glioma progression via the JAK2/STAT3 and NF-κB pathways
Journal: Cell Commun Signal | Authors: Yunji Yan | Species: mouse,human | Application: WB - Activity-based chemical proteomics reveals caffeic acid ameliorates pentylenetetrazol-induced seizures by covalently targeting aconitate decarboxylase 1
Journal: Cell Commun Signal | Authors: Guanjun Li | Species: mouse | Application: WB - High-salt diet downregulates TREM2 expression and blunts efferocytosis of macrophages after acute ischemic stroke.
Journal: J Neuroinflammation | Authors: Mengyan Hu | Species: human | Application: WB - Icariin attenuates neuroinflammation and exerts dopamine neuroprotection via an Nrf2-dependent manner.
Journal: J Neuroinflammation | Authors: Bei Zhang | Species: mouse | Application: WB - Succinate-induced macrophage polarization and RBP4 secretion promote vascular sprouting in ocular neovascularization
Journal: J Neuroinflammation | Authors: Tianyi Shen | Application: WB - Deficiency of leucine-rich repeat kinase 2 aggravates thioacetamide-induced acute liver failure and hepatic encephalopathy in mice
Journal: J Neuroinflammation | Authors: Dan Li | Species: human | Application: IF - Regulatory T cells protect against brain damage by alleviating inflammatory response in neuromyelitis optica spectrum disorder.
Journal: J Neuroinflammation | Authors: Xue Ma | Species: mouse | Application: WB - Gut microbiota-derived indoleacetic acid attenuates neuroinflammation and neurodegeneration in glaucoma through ahr/rage pathway
Journal: J Neuroinflammation | Authors: Ning Wang | Species: mouse | Application: WB,IF - TREM2 activation alleviates neural damage via Akt/CREB/BDNF signalling after traumatic brain injury in mice
Journal: J Neuroinflammation | Authors: Jin Yan | Species: mouse | Application: WB - Exercise-induced irisin ameliorates cognitive impairment following chronic cerebral hypoperfusion by suppressing neuroinflammation and hippocampal neuronal apoptosis.
Journal: J Neuroinflammation | Authors: Weiping Xiao | Species: mouse | Application: WB - Critical roles of sphingosine kinase 1 in the regulation of neuroinflammation and neuronal injury after spinal cord injury.
Journal: J Neuroinflammation | Authors: Chenjian Wang | Species: rat | Application: WB,IF - Deficiency of leucine-rich repeat kinase 2 aggravates thioacetamide-induced acute liver failure and hepatic encephalopathy in mice
Journal: J Neuroinflammation | Authors: Dan Li | Species: human | Application: IF - The protective effect of apolipoprotein H in paediatric sepsis
Journal: Crit Care | Authors: Zhicai Yu | Species: mouse | Application: WB - Gut-resident Phascolarctobacterium succinatutens decreases fat accumulation via MYC-driven epigenetic regulation of arginine biosynthesis
Journal: NPJ Biofilms Microbiomes | Authors: Qun Lan | Species: human | Application: WB - Wen-Shen-Jian-Pi-Hua-Tan decoction protects against early obesity-related glomerulopathy by improving renal bile acid composition and suppressing lipogenesis, inflammation, and fibrosis
Journal: Phytomedicine | Authors: Daofei Song | Species: rat - Biochanin A mitigates colitis by inhibiting ferroptosis-mediated intestinal barrier dysfunction, oxidative stress, and inflammation via the JAK2/STAT3 signaling pathway
Journal: Phytomedicine | Authors: Beiying Deng | Species: mouse,human | Application: WB - Protective effects and potential mechanism of salvianolic acid B on sodium laurate-induced thromboangiitis obliterans in rats.
Journal: Phytomedicine | Authors: Ziru Zhang | Species: rat | Application: IHC - Qihuang Yishen formula attenuates renal tubular injury by modulating inflammation via the cGAS/STING pathway in diabetic kidney disease.
Journal: Phytomedicine | Authors: Yifan Guo | Species: mouse,human | Application: WB - Artemisia argyi polyphenols Attenuates DSS-induced colitis in mice by regulating the structural composition of gut microbiota
Journal: Phytomedicine | Authors: Huaqiang Zhang | Species: mouse | Application: WB - Sclareol alleviates synovial inflammation in knee osteoarthritis by regulating sphingolipid metabolism along the gut-bone axis.
Journal: Phytomedicine | Authors: Lishi Jie | Species: rat | Application: IF - Artemisia argyi polyphenols Attenuates DSS-induced colitis in mice by regulating the structural composition of gut microbiota
Journal: Phytomedicine | Authors: Huaqiang Zhang | Species: mouse | Application: WB - Sclareol alleviates synovial inflammation in knee osteoarthritis by regulating sphingolipid metabolism along the gut-bone axis.
Journal: Phytomedicine | Authors: Lishi Jie | Species: rat | Application: IF - Discovery of cis-Gnetin H from peony seed coat as a potent antifibrotic agent modulating hepatic fibro-inflammatory pathways and gut microbiota homeostasis.
Journal: Phytomedicine | Authors: Rong Yuan - Ganoderma lucidum polysaccharide peptide (GLPP) attenuates rheumatic arthritis in rats through inactivating NF-κB and MAPK signaling pathways
Journal: Phytomedicine | Authors: Meng Meng | Species: rat | Application: WB - Furongtongmai capsule alleviates neuroinflammation by downregulating the TLR4/MyD88/JNK pathway to promote the recovery of peripheral nerve compression
Journal: Phytomedicine | Authors: Huan Liu | Species: rat | Application: IHC - Kakkalide promotes spinal cord injury repair by regulating microglial M2 polarization via mitophagy.
Journal: Phytomedicine | Authors: Tao You | Species: mouse | Application: WB,IF - Kakkalide promotes spinal cord injury repair by regulating microglial M2 polarization via mitophagy.
Journal: Phytomedicine | Authors: Tao You | Species: mouse | Application: WB,IF - Furongtongmai capsule alleviates neuroinflammation by downregulating the TLR4/MyD88/JNK pathway to promote the recovery of peripheral nerve compression
Journal: Phytomedicine | Authors: Huan Liu | Species: rat | Application: IHC - Qihuang Yishen formula attenuates renal tubular injury by modulating inflammation via the cGAS/STING pathway in diabetic kidney disease.
Journal: Phytomedicine | Authors: Yifan Guo | Species: mouse,human | Application: WB - Diosmetin attenuates the ubiquitination of epidermal hypoxia-inducible factor 1 alpha by diminishing the formation of RhoBTB3/PHD2 complex in ultraviolet radiation-induced sunburn in mice
Journal: Phytomedicine | Authors: Xiaobao Gong | Species: mouse | Application: WB,IF - Theaflavin alleviates thoracic aortic dissection by disrupting the interaction between microtubule affinity-regulating kinase 4 and NLRP3 to inhibit inflammasome assembly.
Journal: Phytomedicine | Authors: Xing Chen - Co-administration of berberine and evodiamine: Mitigating evodiamine-induced hepatotoxicity and potentiating colitis treatment
Journal: Phytomedicine | Authors: Xiaoyu Tao | Application: WB - Protective effects of Wenqingyin on sepsis-induced acute lung injury through regulation of the receptor for advanced glycation end products pathway
Journal: Phytomedicine | Authors: Lingpeng Xie | Species: mouse | Application: WB - Pterocephin A, a novel Triterpenoid Saponin from Pterocephalus hookeri induced liver injury by activation of necroptosis.
Journal: Phytomedicine | Authors: Rui Wang | Species: human | Application: WB - Downregulation of cardiac inflammation via the CaMKII δ/NF-κB pathway in heart failure by Lonicerae Japonicae Flos and Angelicae Sinensis Radix
Journal: Phytomedicine | Authors: Jiayang Tang | Species: rat,mouse | Application: WB - Discovery of cis-Gnetin H from peony seed coat as a potent antifibrotic agent modulating hepatic fibro-inflammatory pathways and gut microbiota homeostasis.
Journal: Phytomedicine | Authors: Rong Yuan - Sclareol alleviates synovial inflammation in knee osteoarthritis by regulating sphingolipid metabolism along the gut-bone axis.
Journal: Phytomedicine | Authors: Lishi Jie | Species: rat | Application: IF - 6-shogaol suppresses MAPK14 to attenuate endoplasmic reticulum stress and alleviate alcohol-associated liver disease.
Journal: Phytomedicine | Authors: Fucheng Zuo | Species: mouse | Application: WB, IF - Discovery of cis-Gnetin H from peony seed coat as a potent antifibrotic agent modulating hepatic fibro-inflammatory pathways and gut microbiota homeostasis.
Journal: Phytomedicine | Authors: Rong Yuan - Luteolin ameliorates LPS-induced acute liver injury by inhibiting TXNIP-NLRP3 inflammasome in mice.
Journal: Phytomedicine | Authors: Xiaohui Wang | Species: mouse | Application: WB,IHC - Huzhang-Xiangbaji compounds enhance the repair of meniscal cartilage by inhibiting ferroptosis and inflammatory microenvironment.
Journal: Phytomedicine | Authors: Jiehan Li | Species: rat,mouse,human | Application: WB - Forsythiaside A attenuates mastitis via PINK1/Parkin-mediated mitophagy
Journal: Phytomedicine | Authors: Jingjing Liu | Species: mouse,bovine | Application: WB - Sini decoction alleviates inflammation injury after myocardial infarction through regulating arachidonic acid metabolism
Journal: Chin Herb Med | Authors: Cuiping Long | Species: rat,mouse | Application: WB - Macrophage Inactivation by Small Molecule Wedelolactone via Targeting sEH for the Treatment of LPS-Induced Acute Lung Injury
Journal: ACS Cent Sci | Authors: Juan Zhang | Species: mouse | Application: WB,IHC,IF - sLithospermic acid etched ZIF-8 nanoparticles delays osteoarthritis progression by inhibiting inflammatory signaling pathways and rescuing mitochondrial damage
Journal: Mater Today Bio | Authors: Yu Zhang | Species: mouse | Application: WB,IF - Microfluidic-based biomimetic mitochondrial nanocomposite for targeted immunotherapy of rheumatoid arthritis via mitochondrial transplantation.
Journal: Mater Today Bio | Authors: Nengjie Yang - Curcumin-alendronate carbon dots: A dual-logic strategy for precision treatment of periodontitis
Journal: Mater Today Bio | Authors: Shujian Zhang | Species: mouse | Application: WB,IHC - A dual-functional Janus nanofibrous membrane as an immunomodulatory barrier for periodontitis regeneration under diabetic conditions.
Journal: Mater Today Bio | Authors: Feiyang Wang | Species: rat | Application: IHC - Photothermal-triggered NO-releasing nanofiber membrane mitigates intervertebral disc degeneration via inflammation inhibition and matrix stabilization
Journal: Mater Today Bio | Authors: Guanfeng Huang | Application: WB - Engineered decellularized tendon hydrogel with sustained zinc ion release orchestrates anti-inflammatory microenvironment and functional regeneration in Achilles tendinopathy.
Journal: Mater Today Bio | Authors: Xiang Gao | Species: rat | Application: IF - Platinum-loaded Cerium Oxide Capable of Repairing Neuronal Homeostasis for Cerebral Ischemia-Reperfusion Injury Therapy
Journal: Adv Healthc Mater | Authors: Qiang Zhang | Species: mouse | Application: WB - Curcumin-alendronate carbon dots: A dual-logic strategy for precision treatment of periodontitis
Journal: Mater Today Bio | Authors: Shujian Zhang | Species: mouse | Application: WB,IHC - Engineered decellularized tendon hydrogel with sustained zinc ion release orchestrates anti-inflammatory microenvironment and functional regeneration in Achilles tendinopathy.
Journal: Mater Today Bio | Authors: Xiang Gao | Species: rat | Application: IF - Deliver CEBPE via cartilage targeting Lipid nanoparticle to block CEBPE-LTF-STAT3 positive feedback loop for efficient treatment of cartilage endplate degeneration
Journal: Mater Today Bio | Authors: Jiangminghao Zhao | Species: human | Application: WB - Characterization of Chitosan-Gallic Acid Graft Copolymer for Periodontal Dressing Hydrogel Application
Journal: Adv Healthc Mater | Authors: Mengge Feng | Species: rat | Application: IHC - Nanocolloidal Hydrogel Coatings With Multiple Functions for Antithrombogenic Biointerfaces.
Journal: Adv Healthc Mater | Authors: Tiantian Ding | Species: mouse | Application: IHC - Sorafenib-loaded metal-organic framework nanoparticles for anti-hepatocellular carcinoma effects through synergistically potentiating ferroptosis and remodeling tumor immune microenvironment
Journal: Mater Today Bio | Authors: Yuanliang Yan | Species: mouse,human | Application: WB - Zinc-Containing Bioactive Glass Programs Macrophage Polarization through Extracellular Traps Regulation for Enhanced Diabetic Wound Healing.
Journal: Adv Healthc Mater | Authors: RuiYang Sun | Species: mouse | Application: IHC,IF - Dexamethasone-loaded zeolitic imidazolate frameworks nanocomposite hydrogel with antibacterial and anti-inflammatory effects for periodontitis treatment
Journal: Mater Today Bio | Authors: Ning Li | Species: human | Application: IF - A dual-functional Janus nanofibrous membrane as an immunomodulatory barrier for periodontitis regeneration under diabetic conditions.
Journal: Mater Today Bio | Authors: Feiyang Wang | Species: rat | Application: IHC - Intelligent hyaluronidase-responsive supramolecular nanoassemblies for programmable dual-drug delivery and NIR-II photothermal therapy of atherosclerosis
Journal: Mater Today Bio | Authors: Huixian Liang | Application: WB - Drug-free hyaluronic acid-microneedle with unexpected inhibition activity on benzalkonium chloride-induced corneal inflammation and stromal scarring
Journal: Mater Today Bio | Authors: Baoshan Huang | Species: rat | Application: IF - The multilayer coatings on polylactic acid implants spatiotemporally regulates the microenvironment to enhance antibacterial and osseointegration capacity.
Journal: Mater Today Bio | Authors: Jinyang Lyu | Species: rat | Application: WB - Characterization of Chitosan-Gallic Acid Graft Copolymer for Periodontal Dressing Hydrogel Application
Journal: Adv Healthc Mater | Authors: Mengge Feng | Species: rat | Application: IHC - Bionic intelligent responsive barbed microneedles synergistically remodel the microenvironment for the treatment of refractory pigmentation disorders (melasma).
Journal: Mater Today Bio | Authors: Hao Ding | Species: mouse | Application: WB - Extracellular Vesicles from Adipose-Derived Mesenchymal Stem Cells Combined with PEG Hydrogel Alleviate Maternal Simulated Birth Injury in a Rat Model
Journal: Adv Healthc Mater | Authors: Qing Wang | Species: rat | Application: IHC - Curcumin-alendronate carbon dots: A dual-logic strategy for precision treatment of periodontitis
Journal: Mater Today Bio | Authors: Shujian Zhang | Species: mouse | Application: WB,IHC - sLithospermic acid etched ZIF-8 nanoparticles delays osteoarthritis progression by inhibiting inflammatory signaling pathways and rescuing mitochondrial damage
Journal: Mater Today Bio | Authors: Yu Zhang | Species: mouse | Application: WB,IF - Extracellular Vesicles from Adipose-Derived Mesenchymal Stem Cells Combined with PEG Hydrogel Alleviate Maternal Simulated Birth Injury in a Rat Model
Journal: Adv Healthc Mater | Authors: Qing Wang | Species: rat | Application: IHC - Hsp22 pretreatment protects against LPS-induced hippocampal injury by alleviating neuroinflammation and apoptosis by regulating the NLRP3/Caspase1/IL-1β signaling pathway in mice
Journal: Aging (Albany NY) | Authors: Shengliang Peng | Species: mouse | Application: WB - Oral exposure to polystyrene nanoplastics reduced male fertility and even caused male infertility by inducing testicular and sperm toxicities in mice
Journal: J Hazard Mater | Authors: Wenqing Xu | Species: mouse | Application: WB - Potential mechanisms of aortic medial degeneration promoted by co-exposure to microplastics and lead
Journal: J Hazard Mater | Authors: Xiaoping Xie | Species: mouse | Application: WB,IF - Mild hyperthermia promotes immune checkpoint blockade-based immunotherapy against metastatic pancreatic cancer using size-adjustable nanoparticles.
Journal: Acta Biomater | Authors: Qianwen Yu | Species: mouse | Application: WB - Geniposide alleviates heart failure with preserved ejection fraction in mice by regulating cardiac oxidative stress via MMP2/SIRT1/GSK3β pathway
Journal: Acta Pharmacol Sin | Authors: Yan-Lu Han | Species: mouse | Application: WB - Regulation of acute myocardial infarction by CircTMCC1 through mitochondrial dysfunction and AMPK/mTOR-driven M1 macrophage polarization: role in QFR assessment.
Journal: Cell Death Discov | Authors: Mengmeng Ren | Species: mouse,human | Application: WB - Mild hyperthermia promotes immune checkpoint blockade-based immunotherapy against metastatic pancreatic cancer using size-adjustable nanoparticles.
Journal: Acta Biomater | Authors: Qianwen Yu | Species: mouse | Application: WB - tRNA-derived fragment TRF365 regulates the metabolism of anterior cruciate ligament cells by targeting IKBKB.
Journal: Cell Death Discov | Authors: Dianbo Long | Species: human | Application: WB - Ultrafast water-responsive shape-adaptive magnesium-loaded silk fibroin-based scaffold modulates macrophage glycolytic reprogramming for endogenous cartilage regeneration.
Journal: Acta Biomater | Authors: Zhinan Mao | Species: mouse | Application: IF - JP1, a polypeptide specifically targeting integrin αVβ3, ameliorates choroidal neovascularization and diabetic retinopathy in mice
Journal: Acta Pharmacol Sin | Authors: Zhan Xie | Species: mouse | Application: WB - Inhibition of Zbp1-PANoptosome-mediated PANoptosis effectively attenuates acute pancreatitis
Journal: Cell Death Discov | Authors: Jie Li | Species: mouse | Application: IHC - Geniposide alleviates heart failure with preserved ejection fraction in mice by regulating cardiac oxidative stress via MMP2/SIRT1/GSK3β pathway
Journal: Acta Pharmacol Sin | Authors: Yan-Lu Han | Species: mouse | Application: WB - tRNA-derived fragment TRF365 regulates the metabolism of anterior cruciate ligament cells by targeting IKBKB.
Journal: Cell Death Discov | Authors: Dianbo Long | Species: human | Application: WB - CP-25 enhances OAT1-mediated absorption of methotrexate in synoviocytes of collagen-induced arthritis rats.
Journal: Acta Pharmacol Sin | Authors: Chun Wang | Species: rat | Application: Cell treatment - Bisphenol P exposure in C57BL/6 mice caused gut microbiota dysbiosis and induced intestinal barrier disruption via LPS/TLR4/NF-κB signaling pathway
Journal: Environ Int | Authors: Nana Ma | Species: mouse | Application: WB - DDX41 facilitates PD-L1-mediated immune escape in OSCC via the phase separation and activation STING pathway.
Journal: NPJ Precis Oncol | Authors: Zhen Tian | Species: mouse,human | Application: IHC,IF - Sirt1 protects against intervertebral disc degeneration induced by 1,25-dihydroxyvitamin D insufficiency in mice by inhibiting the NF-κB inflammatory pathway
Journal: J Orthop Translat | Authors: Peng Wang | Species: mouse | Application: WB,IHC,IF - Sirt1 protects against intervertebral disc degeneration induced by 1,25-dihydroxyvitamin D insufficiency in mice by inhibiting the NF-κB inflammatory pathway
Journal: J Orthop Translat | Authors: Peng Wang | Species: mouse | Application: WB,IHC,IF - Effects of chronic low-level lead (Pb) exposure on cognitive function and hippocampal neuronal ferroptosis: An integrative approach using bioinformatics analysis, machine learning, and experimental validation
Journal: Sci Total Environ | Authors: Yingsi Cao | Species: mouse | Application: WB - Biocompatible Pickering Emulsions from Andrias davidianus Byproducts for Promoting Burn Wound Healing
Journal: Biomater Res | Authors: Jianlin Luo - Mas receptor activation regulates the functional phenotype of myocardial macrophages through the Akt/Nrf2 signaling pathway to alleviate sepsis-induced cardiomyopathy.
Journal: J Transl Med | Authors: Xin-Sen Chen | Species: mouse | Application: WB - Magnesium silicate nanosheets enable sustained hydrogen release to attenuate secondary brain injury following intracerebral hemorrhage.
Journal: J Transl Med | Authors: Chang-Sheng Ma | Species: mouse | Application: WB - Djulis beverage attenuates gastric mucosal injury by modulating oxidative stress and inflammation.
Journal: NPJ Sci Food | Authors: Fuad Sauqi Isnain | Species: rat | Application: WB - Nebulized M2 macrophage-derived nanovesicles for the treatment of explosion-induced acute lung injury
Journal: J Colloid Interface Sci | Authors: Linqiang Tian | Species: mouse | Application: WB - Bisphenol P triggers hepatic injury via gut microbiota dysbiosis-Induced intestinal barrier disruption.
Journal: J Environ Manage | Authors: Nana Ma | Species: mouse | Application: WB - Core fucosylation of NCEH1 by FUT8 promotes progression of high-grade serous ovarian cancer by driving tumor-associated macrophage M2 polarization.
Journal: Oncogene | Authors: Xiaosong Pei | Species: mouse,human | Application: WB - ILF2 cooperates with ILF3/KLF16 to drive colorectal cancer progression via modulating the behaviors of both tumor cells and M2 macrophages.
Journal: Apoptosis | Authors: Dong Mao | Species: human | Application: WB - Disruption of sphingolipid metabolism triggers lung vascular inflammation and aging-like changes under hypoxia through VDAC1-mediated mitochondrial DNA release.
Journal: Apoptosis | Authors: Jin Xu | Species: mouse | Application: WB - Circular RNA APP contributes to Alzheimer's disease pathogenesis by modulating microglial polarization via miR-1906/CLIC1 axis
Journal: Alzheimers Res Ther | Authors: Deng-Pan Wu | Species: mouse | Application: WB - Portulaca Oleracea polysaccharides attenuate zearalenone-induced macrophage activation and Leydig cell dysfunction in testis: A single-cell and multi-omics study.
Journal: Food Res Int | Authors: Bingxin Huangfu | Species: mouse | Application: WB - A novel Atlantic salmon (Salmo salar) bone collagen peptide delays osteoarthritis development by inhibiting cartilage matrix degradation and anti-inflammatory
Journal: Food Res Int | Authors: Xianliang Luo | Species: rat | Application: IHC - Regulatory effects of hawthorn polyphenols on hyperglycemic, inflammatory, insulin resistance responses, and alleviation of aortic injury in type 2 diabetic rats
Journal: Food Res Int | Authors: Suwen Liu | Species: rat | Application: WB - Marine bromophenols suppressed choroidal neovascularization by targeting HUWE1 through NF-κb signaling pathway.
Journal: Int J Biol Macromol | Authors: Kepeng Ou | Species: mouse | Application: IHC - ROS scavenging and corneal epithelial wound healing by a self-crosslinked tissue-adhesive hydrogel based-on dual-functionalized hyaluronic acid
Journal: Int J Biol Macromol | Authors: Xin-Yang Pan | Species: mouse | Application: IF - Polyvinyl alcohol/graphene oxide/dextran hydrogel doped copper oxide modified biochar with nano-enzymatic activity and multiple synergistic effects for accelerated diabetic wound healing
Journal: Int J Biol Macromol | Authors: Junran Yang | Species: mouse | Application: WB - Injectable hyaluronate-based hydrogel with a dynamic/covalent dual-crosslinked architecture for bone tissue engineering: Enhancing osteogenesis and immune regulation
Journal: Int J Biol Macromol | Authors: Kunyao Guo | Species: rat | Application: IF - A phellinus igniarius polysaccharide/chitosan-arginine hydrogel for promoting diabetic wound healing
Journal: Int J Biol Macromol | Authors: Lifeng Zhang | Species: mouse | Application: WB - Chitosan-modified dihydromyricetin liposomes promote the repair of liver injury in mice suffering from diabetes mellitus
Journal: Int J Biol Macromol | Authors: Qiteng Ding | Species: mouse | Application: WB - Preparation of nanocomposite membranes loaded with taxifolin liposome and its mechanism of wound healing in diabetic mice
Journal: Int J Biol Macromol | Authors: Qiteng Ding | Species: mouse | Application: WB - Structure and preliminary anti-inflammatory activity of a novel sulfated α-glucan from Volutharpa ampullacea perryi
Journal: Int J Biol Macromol | Authors: Yiling Chen | Species: mouse | Application: IHC,ELISA - La2O3 Nanoparticles Induce Reproductive Toxicity Mediated by the Nrf-2/ARE Signaling Pathway in Kunming Mice.
Journal: Int J Nanomedicine | Authors: Lu Yuan | Species: mouse | Application: WB - La2O3 Nanoparticles Induce Reproductive Toxicity Mediated by the Nrf-2/ARE Signaling Pathway in Kunming Mice.
Journal: Int J Nanomedicine | Authors: Lu Yuan | Species: mouse | Application: WB - Application of multifunctional hydrogels loaded with kaempferol liposomes based on oxidized hyaluronic acid and N-aminated gelatin matrix in promoting diabetic wound healing.
Journal: Int J Biol Macromol | Authors: Anqi Sheng - Chitosan-modified dihydromyricetin liposomes promote the repair of liver injury in mice suffering from diabetes mellitus
Journal: Int J Biol Macromol | Authors: Qiteng Ding | Species: mouse | Application: WB - Artificial nonenzymatic antioxidant Prussian blue/KGM-BSA nanocomposite hydrogel dressing as ROS scavenging for diabetic wound healing
Journal: Int J Biol Macromol | Authors: Dong-Xu Tang | Species: rat | Application: IF - CEBPA as a potential hub gene for cutaneous inflammation in type 2 diabetes mellitus
Journal: Int J Biol Macromol | Authors: Mingzheng Han | Species: human | Application: WB - MgFe-Layered Double Hydroxide-Reinforced Injectable GelMA Hydrogels Promote Calvarial Bone Regeneration with IL-10RA-JAK1-STAT3-Associated Osteoimmunomodulation.
Journal: Int J Nanomedicine | Authors: Jiajie Zheng | Application: IF - Locally controlled release of immunosuppressive promotes survival of transplanted adult spinal cord tissue
Journal: Regen Biomater | Authors: Ziqiang Wang | Species: mouse | Application: IF - Construction of Baicalein-Loaded Chitosan Nanoparticles for Staphylococcus aureus-Induced Lung Infection Remission.
Journal: Int J Nanomedicine | Authors: Jizhao Wang | Species: mouse | Application: WB - Dihydroquercetin alleviates dopamine neuron loss via regulating TREM2 activation
Journal: Int J Biol Macromol | Authors: Rong Yang | Species: rat,mouse | Application: WB - A thermally stable bioactive chitosan scaffold with pH-responsive exosome adsorption and release function promotes wound healing
Journal: Int J Biol Macromol | Authors: Jifang Yuan | Application: IHC - A novel glucomannan from Bletilla striata ameliorates colitis: Restores intestinal barrier, alleviates inflammation, and modulates the gut flora
Journal: Int J Biol Macromol | Authors: Xialin Sun - Self-Assembled Carrier Free Oligomeric Proanthocyanidin/Tetrandrine Nanoparticles Ameliorate Osteoarthritis via Anti-Inflammatory and Anti-Ferroptotic Pathways.
Journal: Int J Nanomedicine | Authors: Chengyuan Xing | Species: mouse | Application: IHC,IF - Methacrylated sericin/methacrylated hyaluronic acid composite microneedles with exosomes for diabetic wound healing
Journal: Int J Biol Macromol | Authors: Xinhao Xu | Species: mouse | Application: IHC - Marine bromophenols suppressed choroidal neovascularization by targeting HUWE1 through NF-κb signaling pathway.
Journal: Int J Biol Macromol | Authors: Kepeng Ou | Species: mouse | Application: IHC - A dual-pronged glycopeptide hydrogel promotes diabetic wound healing by synchronizing metabolic-angiogenic recoupling.
Journal: Int J Biol Macromol | Authors: Cheng Xu | Species: mouse | Application: IHC - Photocrosslinked carboxymethylcellulose-based hydrogels: Synthesis, characterization for curcumin delivery and wound healing
Journal: Int J Biol Macromol | Authors: Jingfei Wang | Species: human | Application: IHC - MgFe-Layered Double Hydroxide-Reinforced Injectable GelMA Hydrogels Promote Calvarial Bone Regeneration with IL-10RA-JAK1-STAT3-Associated Osteoimmunomodulation.
Journal: Int J Nanomedicine | Authors: Jiajie Zheng | Application: IF - The role of phlorizin liposome-embedded oxidized sodium alginate/carboxymethyl chitosan in diabetic wound healing
Journal: Int J Biol Macromol | Authors: Xiaoyu Wu | Species: mouse | Application: WB - Locally controlled release of immunosuppressive promotes survival of transplanted adult spinal cord tissue
Journal: Regen Biomater | Authors: Ziqiang Wang | Species: mouse | Application: IF - The role of phlorizin liposome-embedded oxidized sodium alginate/carboxymethyl chitosan in diabetic wound healing
Journal: Int J Biol Macromol | Authors: Xiaoyu Wu | Species: mouse | Application: WB - Marine bromophenols suppressed choroidal neovascularization by targeting HUWE1 through NF-κb signaling pathway.
Journal: Int J Biol Macromol | Authors: Kepeng Ou | Species: mouse | Application: IHC - Methacrylated sericin/methacrylated hyaluronic acid composite microneedles with exosomes for diabetic wound healing
Journal: Int J Biol Macromol | Authors: Xinhao Xu | Species: mouse | Application: IHC - Damage to the blood‑brain barrier and activation of neuroinflammation by focal cerebral ischemia under hyperglycemic condition.
Journal: Int J Mol Med | Authors: Yongzhen Guo | Species: rat | Application: WB - Complex TNF-α B cell epitope MAP vaccine alleviates murine ulcerative colitis.
Journal: Int J Mol Med | Authors: Yan Sun | Species: mouse | Application: WB - Integrative transcriptomic analysis unveils FXR as a key regulator of intestinal stemness and inflammation in ulcerative colitis.
Journal: Int J Mol Med | Authors: Ao Lin | Species: mouse | Application: WB - Cynarin as a potent anti‑osteolytic agent: Targeting MAPK and Nrf2‑Keap1 pathways for osteoclast inhibition and bone protection.
Journal: Int J Mol Med | Authors: Rui Chao | Species: mouse | Application: IHC - Damage to the blood‑brain barrier and activation of neuroinflammation by focal cerebral ischemia under hyperglycemic condition.
Journal: Int J Mol Med | Authors: Yongzhen Guo | Species: rat | Application: WB - Hepatic p38γ exacerbates acetaminophen‑induced acute liver injury via PI3K/Akt‑dependent mechanisms.
Journal: Int J Mol Med | Authors: Hui Fang | Species: mouse | Application: WB,IHC - Ruxolitinib improves the inflammatory microenvironment, restores glutamate homeostasis, and promotes functional recovery after spinal cord injury
Journal: Neural Regen Res | Authors: Jiang Cao | Species: mouse | Application: IF - Vagus nerve stimulation is a potential treatment for ischemic stroke
Journal: Neural Regen Res | Authors: Yi-Lin Liu | Species: rat | Application: WB - Cynarin as a potent anti‑osteolytic agent: Targeting MAPK and Nrf2‑Keap1 pathways for osteoclast inhibition and bone protection.
Journal: Int J Mol Med | Authors: Rui Chao | Species: mouse | Application: IHC - miR‑4792 regulates inflammatory responses in Cryptococcus neoformans‑infected microglia.
Journal: Int J Mol Med | Authors: Guotai Yao | Species: mouse | Application: WB - Hyperoxia-activated Nrf2 regulates ferroptosis in intestinal epithelial cells and intervenes in inflammatory reaction through COX-2/PGE2/EP2 pathway
Journal: Mol Med | Authors: Yanping Liu | Species: rat,human | Application: WB - Omentin-1 inhibits the development of benign prostatic hyperplasia by attenuating local inflammation
Journal: Mol Med | Authors: Yi-Yi Wang | Species: mouse | Application: IHC - HSPA1A inhibits pyroptosis and neuroinflammation after spinal cord injury via DUSP1 inhibition of the MAPK signaling pathway
Journal: Mol Med | Authors: Xuegang He | Species: rat | Application: WB - LXRα agonists ameliorates acute rejection after liver transplantation via ABCA1/MAPK and PI3K/AKT/mTOR signaling axis in macrophages
Journal: Mol Med | Authors: Xiaoyan Qin | Species: rat | Application: WB - Oxybaphus himalaicus Mitigates Lipopolysaccharide-Induced Acute Kidney Injury by Inhibiting TLR4/MD2 Complex Formation
Journal: Antioxidants (Basel) | Authors: Honghong Zhan | Species: mouse | Application: WB - Protective Mechanisms of Polyphenol-Enriched Blueberry Preparation in Preventing Inflammation in the Skin against UVB-Induced Damage in an Animal Model
Journal: Antioxidants (Basel) | Authors: Nawal Alsadi | Species: mouse | Application: WB - Macrophage SCAP Contributes to Metaflammation and Lean NAFLD by Activating STING-NF-κB Signaling Pathway
Journal: Cell Mol Gastroenterol Hepatol | Authors: Xinyu Huang | Species: mouse | Application: WB - MiR155-5p Inhibits Cell Migration and Oxidative Stress in Vascular Smooth Muscle Cells of Spontaneously Hypertensive Rats.
Journal: Antioxidants (Basel) | Authors: Nan Wu | Species: rat | Application: WB - Metabolic Syndrome Develops Cardia Cancer via Nuclear Factor-E2-related Factor 2-Programmed Death-Ligand 1 Signaling.
Journal: Cell Mol Gastroenterol Hepatol | Authors: Keisuke Kusano | Species: mouse | Application: IHC,WB - Antioxidative Sirt1 and the Keap1-Nrf2 Signaling Pathway Impair Inflammation and Positively Regulate Autophagy in Murine Mammary Epithelial Cells or Mammary Glands Infected with Streptococcus uberis
Journal: Antioxidants (Basel) | Authors: Sohrab Khan | Species: mouse | Application: WB - Metabolic Syndrome Develops Cardia Cancer via Nuclear Factor-E2-related Factor 2-Programmed Death-Ligand 1 Signaling.
Journal: Cell Mol Gastroenterol Hepatol | Authors: Keisuke Kusano | Species: mouse | Application: IHC,WB - Astragaloside IV Alleviates Acute Hepatic Injury by Regulating Macrophage Polarization and Pyroptosis via Activation of the AMPK/SIRT1 Signaling Pathway
Journal: Phytother Res | Authors: Gang Kuang | Species: mouse | Application: WB - Leonurine Attenuates Ischemia-Reperfusion Injury Through PI3K/AKT/mTOR Pathway in Mouse Liver.
Journal: Phytother Res | Authors: Pengru Wang | Species: mouse | Application: WB - Curcumin suppress inflammatory response in traumatic brain injury via p38/MAPK signaling pathway
Journal: Phytother Res | Authors: Guoqiang Li | Species: mouse | Application: WB - Paeoniflorin Attenuates the Progression of Diabetic Kidney Disease by Regulating Macrophage Differentiation.
Journal: Phytother Res | Authors: Chunru Shi | Species: mouse | Application: WB - Critical role of caveolin-1 in intestinal ischemia reperfusion by inhibiting protein kinase C βII
Journal: Free Radic Biol Med | Authors: Zhao Chen | Species: mouse | Application: ELISA - Troxerutin mitigates ferroptosis-related neuroinflammation by regulating the microglial NOX4/Nrf2 axis in Parkinson's disease.
Journal: Free Radic Biol Med | Authors: Qicheng Wang - Apoptotic extracellular vesicles derived from UC-MSCs promote spinal cord injury repair by inhibiting ferroptosis via OTUD1.
Journal: Free Radic Biol Med | Authors: Dadi Li | Species: mouse | Application: WB - Inhibition of endothelial ALOX12 mitigates cerebral ischemia-reperfusion injury by suppressing 12-HETE.
Journal: Free Radic Biol Med | Authors: Tao Wang | Species: mouse | Application: WB - NOD2 Promotes Sepsis-Induced Neuroinflammation by Increasing Brain Endoplasmic Reticulum Stress Mediated by LACC1
Journal: Free Radic Biol Med | Authors: Lingling Yi | Species: mouse | Application: WB - Aristolochic acid I exposure triggers ovarian dysfunction by activating NLRP3 inflammasome and affecting mitochondrial homeostasis
Journal: Free Radic Biol Med | Authors: Ming-Xin Sun | Species: mouse | Application: WB,IHC - Pumilio2 deficiency promotes iron-dependent macrophage inflammation via TfR1 upregulation in lupus.
Journal: Free Radic Biol Med | Authors: Xuefei Wang | Species: mouse | Application: WB - Critical role of caveolin-1 in intestinal ischemia reperfusion by inhibiting protein kinase C βII
Journal: Free Radic Biol Med | Authors: Zhao Chen | Species: mouse | Application: ELISA - Identification of Cytochrome P450 2E1 as a Novel Target in Neuroinflammation and Development of Its Inhibitor Q11 as a Treatment Strategy
Journal: Free Radic Biol Med | Authors: Rui Yang | Species: mouse | Application: WB - Oligodendrocyte-specific knockout of FPN1 affects CNS myelination defects and depression-like behavior in mice
Journal: Free Radic Biol Med | Authors: Na Zhang - Inhibition of endothelial ALOX12 mitigates cerebral ischemia-reperfusion injury by suppressing 12-HETE.
Journal: Free Radic Biol Med | Authors: Tao Wang | Species: mouse | Application: WB - MAGL inhibition relieves synovial inflammation and pain via regulating NOX4-Nrf2 redox balance in osteoarthritis
Journal: Free Radic Biol Med | Authors: Xueyan Li | Species: human | Application: WB - Troxerutin mitigates ferroptosis-related neuroinflammation by regulating the microglial NOX4/Nrf2 axis in Parkinson's disease.
Journal: Free Radic Biol Med | Authors: Qicheng Wang - Topical transdermal administration of lenalidomide nanosuspensions-based hydrogels against melanoma: In vitro and in vivo studies
Journal: Int J Pharm X | Authors: Mengdi Zhang | Species: mouse | Application: IF - Effects of Enteromorpha prolifera polysaccharides on growth performance, intestinal barrier function and cecal microbiota in yellow-feathered broilers under heat stress
Journal: J Anim Sci Biotechnol | Authors: Wenchao Liu | Application: WB - Core-Shell Structured Nanozyme with PDA-Mediated Enhanced Antioxidant Efficiency to Treat Early Intervertebral Disc Degeneration
Journal: ACS Appl Mater Interfaces | Authors: Jing Wang | Species: rat | Application: IF - Maslinic Acid Ameliorates Myocardial Ischemia Reperfusion Injury-Induced Oxidative Stress via Activating Nrf2 and Inhibiting NF-[Formula: see text]B Pathways
Journal: Am J Chin Med | Authors: Qi Li | Species: rat | Application: WB - 3D-Printed Silk Sericin-Based Hydrogel Scaffold：A Promising Visualized Dressing Material for Real-Time Monitoring of Wounds.
Journal: ACS Appl Mater Interfaces | Authors: Chang-Sheng Chen | Species: mouse | Application: IHC - Comparative evaluation of the therapeutic efficacy between human amniotic epithelial cells and human umbilical cord mesenchymal stem cells in premature ovarian insufficiency.
Journal: Stem Cell Res Ther | Authors: Qinyu Zhang | Species: mouse | Application: WB,IF - ROS-Responsive Prodrug Containing Dihydroartemisinin and Cinnamaldehyde for the Potential Treatment of Nonalcoholic Steatohepatitis.
Journal: ACS Appl Mater Interfaces | Authors: Ru Hao | Species: mouse | Application: WB,IF - Mesenchymal stem cell-derived exosome miR-542-3p suppresses inflammation and prevents cerebral infarction.
Journal: Stem Cell Res Ther | Authors: Guofeng Cai | Species: human | Application: WB - Core-Shell Structured Nanozyme with PDA-Mediated Enhanced Antioxidant Efficiency to Treat Early Intervertebral Disc Degeneration
Journal: ACS Appl Mater Interfaces | Authors: Jing Wang | Species: rat | Application: IF - Exosomes from adipose-derived stem cells accelerate wound healing by increasing the release of IL-33 from macrophages
Journal: Stem Cell Res Ther | Authors: Yichen Wang | Species: mouse - Mesenchymal stem cells ameliorate renal fibrosis by galectin-3/Akt/GSK3β/Snail signaling pathway in adenine-induced nephropathy rat.
Journal: Stem Cell Res Ther | Authors: Huajun Tang | Species: rat | Application: WB - hUC-MSCs and derived exosomes attenuate DEX-induced muscle atrophy through modulation of estrogen signaling pathway
Journal: Stem Cell Res Ther | Authors: Na Li | Species: mouse,human | Application: WB - Core-Shell Structured Nanozyme with PDA-Mediated Enhanced Antioxidant Efficiency to Treat Early Intervertebral Disc Degeneration
Journal: ACS Appl Mater Interfaces | Authors: Jing Wang | Species: rat | Application: IF - Mesenchymal stem cell-derived exosome miR-542-3p suppresses inflammation and prevents cerebral infarction.
Journal: Stem Cell Res Ther | Authors: Guofeng Cai | Species: human | Application: WB - Mitochondrial-Targeting Drug-Loaded Nanoparticles Reprogram Macrophage Metabolism via ROS/NO Co-elimination for Diabetic Wound Healing.
Journal: ACS Appl Mater Interfaces | Authors: Xuan Zhou | Species: mouse | Application: IF, IHC - Resolvin E1 accelerates pulp repair by regulating inflammation and stimulating dentin regeneration in dental pulp stem cells.
Journal: Stem Cell Res Ther | Authors: Jie Chen | Species: rat | Application: IHC - CASIN exerts anti-aging effects through RPL4 on the skin of naturally aging mice
Journal: Aging Cell | Authors: Yijia Zhang | Species: mouse | Application: IHC - Excessive processing and acetylation of OPA1 aggravate age-related hearing loss via the dysregulation of mitochondrial dynamics
Journal: Aging Cell | Authors: Andi Zhang | Species: mouse | Application: WB - Alleviation of acute pancreatitis-associated lung injury by inhibiting the p38 mitogen-activated protein kinase pathway in pulmonary microvascular endothelial cells.
Journal: World J Gastroenterol | Authors: Xiao-Xin Zhang | Species: rat | Application: WB - Aconitine induces cardiomyocyte damage by mitigating BNIP3-dependent mitophagy and the TNFα-NLRP3 signalling axis.
Journal: Cell Prolif | Authors: Fu Peng | Species: rat | Application: WB - CB2R activation ameliorates late adolescent chronic alcohol exposure-induced anxiety-like behaviors during withdrawal by preventing morphological changes and suppressing NLRP3 inflammasome activation in the microglia of the prefrontal cortex in mice
Journal: Brain Behav Immun | Authors: Jiande Li | Species: mouse | Application: WB - The microglial innate immune receptors TREM-1 and TREM-2 in the anterior cingulate cortex (ACC) drive visceral hypersensitivity and depressive-like behaviors following DSS-induced colitis
Journal: Brain Behav Immun | Authors: Ke Wu | Species: mouse | Application: WB - Long-term social isolation during adolescence exacerbated cardiac dysfunction after myocardial infarction.
Journal: Transl Psychiatry | Authors: Yuan Yao | Species: mouse | Application: WB - The plant extract PNS mitigates atherosclerosis via promoting Nrf2-mediated inhibition of ferroptosis through reducing USP2-mediated Keap1 deubiquitination
Journal: Br J Pharmacol | Authors: Yun Zhao | Species: mouse | Application: WB - The microglial innate immune receptors TREM-1 and TREM-2 in the anterior cingulate cortex (ACC) drive visceral hypersensitivity and depressive-like behaviors following DSS-induced colitis
Journal: Brain Behav Immun | Authors: Ke Wu | Species: mouse | Application: WB - CB2R activation ameliorates late adolescent chronic alcohol exposure-induced anxiety-like behaviors during withdrawal by preventing morphological changes and suppressing NLRP3 inflammasome activation in the microglia of the prefrontal cortex in mice
Journal: Brain Behav Immun | Authors: Jiande Li | Species: mouse | Application: WB - Long-term social isolation during adolescence exacerbated cardiac dysfunction after myocardial infarction.
Journal: Transl Psychiatry | Authors: Yuan Yao | Species: mouse | Application: WB - Schisandrol B inhibits calcification of aortic valve by targeting p53 related inflammatory and senescence
Journal: Biomed Pharmacother | Authors: Xing Liu | Species: mouse | Application: IHC - 20(S)-ginsenoside Rh2 induces caspase-dependent promyelocytic leukemia-retinoic acid receptor A degradation in NB4 cells via Akt/Bax/caspase9 and TNF-α/caspase8 signaling cascades.
Journal: J Ginseng Res | Authors: Sirui Zhu | Species: human | Application: WB - HMGB1-mediated differential response on hippocampal neurotransmitter disorder and neuroinflammation in adolescent male and female mice following cold exposure.
Journal: Brain Behav Immun | Authors: Bin Xu | Species: mouse | Application: WB - 20(S)-ginsenoside Rh2 induces caspase-dependent promyelocytic leukemia-retinoic acid receptor A degradation in NB4 cells via Akt/Bax/caspase9 and TNF-α/caspase8 signaling cascades.
Journal: J Ginseng Res | Authors: Sirui Zhu | Species: human | Application: WB - Chicoric acid exerts therapeutic effects in DSS-induced ulcerative colitis by targeting the USP9X/IGF2BP2 axis
Journal: Br J Pharmacol | Authors: Wei Chen | Species: mouse - The microglial innate immune receptors TREM-1 and TREM-2 in the anterior cingulate cortex (ACC) drive visceral hypersensitivity and depressive-like behaviors following DSS-induced colitis
Journal: Brain Behav Immun | Authors: Ke Wu | Species: mouse | Application: WB - Exploration of the mechanisms of Ge Gen Decoction against influenza A virus infection.
Journal: Chin J Nat Med | Authors: Zi-Kai Geng | Application: WB - Host-microbiota interactions in collagen-induced arthritis rats treated with human umbilical cord mesenchymal stem cell exosome and ginsenoside Rh2
Journal: Biomed Pharmacother | Authors: Zhongsheng Zhou | Species: rat | Application: IHC - Red nucleus IL-15 facilitates the development of neuropathic pain in male rats by inducing inflammatory factors: implying the involvement of NF-κB and p38 MAPK.
Journal: Brain Behav Immun | Authors: Miao-Miao Zhang | Species: rat | Application: IHC - Platelet factor 4 prevents neuroinflammation and neurodegeneration in Parkinson's disease model via regulating protocadherin gamma/Pyk2 pathway.
Journal: Brain Behav Immun | Authors: Pinyuan Huang | Species: mouse | Application: WB - The effects of Atractylodes macrocephala extract BZEP self-microemulsion based on gut-liver axis HDL/LPS signaling pathway to ameliorate metabolic dysfunction-associated fatty liver disease in rats
Journal: Biomed Pharmacother | Authors: Bo Li | Species: rat | Application: IHC - Liver injury induced in Balb/c mice by PM2.5 exposure and its alleviation by compound essential oils.
Journal: Biomed Pharmacother | Authors: Ping Ya | Species: mouse | Application: WB - Isorhamnetin: A hepatoprotective flavonoid inhibits apoptosis and autophagy via P38/PPAR-α pathway in mice.
Journal: Biomed Pharmacother | Authors: Xiya Lu | Species: mouse | Application: WB,IHC - Yiqi Wenyang Formula ameliorates diabetic kidney disease via inhibiting inflammation and regulating the gut microbiota-bile acid axis in mice by FXR signaling pathway.
Journal: Chin Med | Authors: Tongyi Yuan | Species: mouse | Application: WB - Cayratia albifolia C.L.Li exerts anti-rheumatoid arthritis effect by inhibiting macrophage activation and neutrophil extracellular traps (NETs)
Journal: Chin Med | Authors: Wei Wang | Species: rat | Application: IHC - Cayratia albifolia C.L.Li exerts anti-rheumatoid arthritis effect by inhibiting macrophage activation and neutrophil extracellular traps (NETs)
Journal: Chin Med | Authors: Wei Wang | Species: rat | Application: IHC - Canonical Transient Receptor Potential Channel 3 Contributes to Febrile Seizure Inducing Neuronal Cell Death and Neuroinflammation.
Journal: Cell Mol Neurobiol | Authors: Dan Sun | Species: rat | Application: IF - Yiqi Wenyang Formula ameliorates diabetic kidney disease via inhibiting inflammation and regulating the gut microbiota-bile acid axis in mice by FXR signaling pathway.
Journal: Chin Med | Authors: Tongyi Yuan | Species: mouse | Application: WB - Dingzhen pills inhibit neuronal ferroptosis and neuroinflammation by inhibiting the cGAS-STING pathway for Parkinson's disease mice
Journal: Chin Med | Authors: Gaoshuang Fu | Species: mouse | Application: IF - BMP6, a potential biomarker of inflammatory fibrosis and promising protective factor for dilated cardiomyopathy
Journal: Chin Med | Authors: Feng Jiang | Species: rat | Application: WB - Gegen-Qinlian decoction alleviates anxiety-like behaviors in methamphetamine-withdrawn mice by regulating Akkermansia and metabolism in the colon
Journal: Chin Med | Authors: Xue Lu | Species: mouse | Application: WB - Methane-Rich Saline Alleviates CA/CPR Brain Injury by Inhibiting Oxidative Stress, Microglial Activation-Induced Inflammatory Responses, and ER Stress-Mediated Apoptosis.
Journal: Oxid Med Cell Longev | Authors: Ruixia Cui | Species: rat | Application: WB - Study on Protection of Human Umbilical Vein Endothelial Cells from Amiodarone-Induced Damage by Intermedin through Activation of Wnt/β-Catenin Signaling Pathway.
Journal: Oxid Med Cell Longev | Authors: Yanhong Wang | Species: human | Application: WB - Pretreatment with Roxadustat (FG-4592) Attenuates Folic Acid-Induced Kidney Injury through Antiferroptosis via Akt/GSK-3β/Nrf2 Pathway.
Journal: Oxid Med Cell Longev | Authors: Xue Li | Species: mouse | Application: WB,IHC - HBO1 as an Important Target for the Treatment of CCL4-Induced Liver Fibrosis and Aged-Related Liver Aging and Fibrosis
Journal: Oxid Med Cell Longev | Authors: Baopeng Xing | Species: mouse | Application: IHC,IF - Ellagic Acid Protects Dopamine Neurons via Inhibition of NLRP3 Inflammasome Activation in Microglia.
Journal: Oxid Med Cell Longev | Authors: Xue-Mei He | Species: rat | Application: WB - Melatonin Alleviates Acute Kidney Injury by Inhibiting NRF2/Slc7a11 Axis-Mediated Ferroptosis
Journal: Oxid Med Cell Longev | Authors: Yue-Bo Huang | Species: human | Application: IHC - Chlorogenic Acid Alleviates Colon Mucosal Damage Induced by a High-Fat Diet via Gut Microflora Adjustment to Increase Short-Chain Fatty Acid Accumulation in Rats.
Journal: Oxid Med Cell Longev | Authors: M Gui Xie | Species: rat | Application: WB - Aloin Preconditioning Attenuates Hepatic Ischemia/Reperfusion Injury via Inhibiting TLR4/MyD88/NF-κB Signal Pathway In Vivo and In Vitro.
Journal: Oxid Med Cell Longev | Authors: Yichao Du | Species: mouse | Application: WB - Placental trophoblast-specific overexpression of chemerin induces preeclampsia-like symptoms.
Journal: Clin Sci (Lond) | Authors: Lunbo Tan | Species: mouse | Application: WB - Hijacking the Hydrogen Sulfide Axis: A Novel 4-Trifluoromethylquinoline Derivative Suppresses Glioblastoma via Cystathionine γ-Lyase Suppression.
Journal: J Med Chem | Authors: Zhiqiong Luo | Species: human | Application: WB - Activation of G protein-coupled estrogen receptor protects intestine from ischemia/reperfusion injury in mice by protecting the crypt cell proliferation.
Journal: Clin Sci (Lond) | Authors: Shiquan Chai | Species: mouse | Application: WB - Short-chain fatty acids alleviated fluoride-induced neuroinflammation via the gut-brain axis in rats.
Journal: Environ Pollut | Authors: Wen-Peng Zhao | Species: rat | Application: IF - PM2.5 exposure-induced senescence-associated secretory phenotype in airway smooth muscle cells contributes to airway remodeling
Journal: Environ Pollut | Authors: Pei-Pei Cheng | Species: rat,mouse,human | Application: WB,IHC,IF - Trimethylamine N-oxide aggravates human aortic valve interstitial cell inflammation by regulating the macrophages polarization through a N6-methyladenosine-mediated pathway
Journal: Atherosclerosis | Authors: Liming Wen | Species: human | Application: WB - Exercise training-induced plaque stabilization in rabbits associated with restored β(2)-adrenergic receptor signaling and reduced ectopic trypsin.
Journal: Atherosclerosis | Authors: Xin Liu | Species: rabbit | Application: WB - cAMP-MFN2 signaling suppresses cochlear cell senescence and age-related hearing loss.
Journal: Front Immunol | Authors: Yu Liu | Species: mouse | Application: WB - Synergistic effects of platelet-rich fibrin and CTLA4Ig gene-transfected porcine skin on accelerating wound healing in a rat model of deep second-degree burns: a mechanistic study.
Journal: Front Immunol | Authors: Jiliang Li | Species: rat | Application: IHC - The influence of angiopoietin-like protein 3 on macrophages polarization and its effect on the podocyte EMT in diabetic nephropathy
Journal: Front Immunol | Authors: Yanli Ma | Species: mouse | Application: IF - Resveratrol Alleviates Levodopa-Induced Dyskinesia in Rats.
Journal: Front Immunol | Authors: Chang-Qing Zheng | Species: rat | Application: WB - Role of Tim-3 in Decidual Macrophage Functional Polarization During Abnormal Pregnancy With Toxoplasma gondii Infection.
Journal: Front Immunol | Authors: Dan Zhang | Species: mouse | Application: WB - cAMP-MFN2 signaling suppresses cochlear cell senescence and age-related hearing loss.
Journal: Front Immunol | Authors: Yu Liu | Species: mouse | Application: WB - Exercise preconditioning and resveratrol reduce the susceptibility of rats with obstructive jaundice to endotoxin and alleviate lung injury
Journal: Front Immunol | Authors: Xujiong Li | Species: rat | Application: IHC - Synergistic effects of platelet-rich fibrin and CTLA4Ig gene-transfected porcine skin on accelerating wound healing in a rat model of deep second-degree burns: a mechanistic study.
Journal: Front Immunol | Authors: Jiliang Li | Species: rat | Application: IHC - Artesunate directly targeting MMP9 to reduce angiogenesis and increase CD8 + T cell infiltration inhibits hepatocellular carcinoma.
Journal: Cancer Cell Int | Authors: Ning Wang | Species: mouse | Application: IF - Vericiguat attenuates cyclosporine A-induced nephropathy by targeting the NF-κB/TGF-β1 axis: an integrated network pharmacology, Mendelian randomization, and experimental study.
Journal: Front Immunol | Authors: XuanKe Liu | Species: mouse | Application: IF - Exercise preconditioning and resveratrol reduce the susceptibility of rats with obstructive jaundice to endotoxin and alleviate lung injury
Journal: Front Immunol | Authors: Xujiong Li | Species: rat | Application: IHC - Role of Tim-3 in Decidual Macrophage Functional Polarization During Abnormal Pregnancy With Toxoplasma gondii Infection.
Journal: Front Immunol | Authors: Dan Zhang | Species: mouse | Application: WB - Hyperhomocysteinaemia aggravates periodontitis by suppressing the Nrf2/HO-1 signalling pathway
Journal: Redox Rep | Authors: Kaiqiang Yang | Species: mouse | Application: WB - The protective effect of proanthocyanidins on the psoriasis-like cell models via PI3K/AKT and HO-1
Journal: Redox Rep | Authors: Yangmeng Zhao | Species: human | Application: Cell treatment - Sirtuin 5-mediated desuccinylation of PRDX6 inhibits ferroptosis and alleviates sepsis-associated acute kidney injury.
Journal: Redox Rep | Authors: Wenlong Lin | Species: mouse,human | Application: WB - Integrated single-cell transcriptomics and proteomics reveal cellular-specific response and microenvironment remodeling in aristolochic acid nephropathy.
Journal: JCI Insight | Authors: Jiayun Chen | Species: mouse | Application: WB - Evaluation of anti-hyperuricemic and nephroprotective activities and discovery of new XOD inhibitors of Morus alba L. root bark
Journal: J Ethnopharmacol | Authors: Yan-Ao Wang | Species: mouse | Application: WB - Yi-shen-hua-shi granules modulate immune and inflammatory damage via the ALG3/PPARγ/NF-κB pathway in the treatment of immunoglobulin a nephropathy
Journal: J Ethnopharmacol | Authors: Rongjia Xu | Species: rat | Application: WB - Uncovering the mechanisms of Zhubi decoction against rheumatoid arthritis through an integrated study of network pharmacology, metabolomics, and intestinal flora
Journal: J Ethnopharmacol | Authors: Jing Liu | Species: rat | Application: IF - Luteolin modulates macrophage phenotypic switching via the AMPK-PPARγ pathway to alleviate ulcerative colitis in mice
Journal: J Ethnopharmacol | Authors: Shuai Yang | Species: mouse | Application: WB - Tongqiao huoxue decoction in improving vascular cognitive impairment in rats through PI3K-AKT pathway
Journal: J Ethnopharmacol | Authors: Jingwen Wu | Application: WB - Ethanol extracts of Rhaponticum uniflorum (L.) DC inflorescence ameliorate LPS-mediated acute lung injury by alleviating inflammatory responses via the Nrf2/HO-1 signaling pathway.
Journal: J Ethnopharmacol | Authors: Dong Zhen | Species: mouse | Application: WB - Exploring the efficacy and mechanism of Bailing capsule to improve polycystic ovary syndrome in mice based on intestinal-derived LPS-TLR4 pathway
Journal: J Ethnopharmacol | Authors: Hao-Ru Guan | Species: human | Application: IHC - Uncovering the mechanisms of Zhubi decoction against rheumatoid arthritis through an integrated study of network pharmacology, metabolomics, and intestinal flora
Journal: J Ethnopharmacol | Authors: Jing Liu | Species: rat | Application: IF - The protective role of Cordyceps cicadae and its active ingredient Myriocin against sodium iodate-induced age-related macular degeneration via an anti-necroptotic TNF-RIPK1/3 pathway
Journal: J Ethnopharmacol | Authors: Shao-Zhuang Ma | Species: human | Application: WB - Protective effect and mechanism of synagrantol A from Euphorbia pseudomollis on LPS-induced neuroinflammation.
Journal: J Ethnopharmacol | Authors: Qingwen Hu | Species: mouse | Application: WB - Nuclear Factor Erythroid 2-Related Factor 2 Activator DDO-1039 Ameliorates Podocyte Injury in Diabetic Kidney Disease via Suppressing Oxidative Stress, Inflammation, and Ferroptosis
Journal: Antioxid Redox Signal | Authors: Xing Liu | Application: WB - Cepharanthine relieves nonalcoholic steatohepatitis through inhibiting STAT1/CXCL10 axis-mediated lipogenesis and inflammatory responses
Journal: J Ethnopharmacol | Authors: Pan Li | Species: rat,human - Bie-Jia-Jian Pill: Inhibiting tumor glycolysis and promoting CD8(+) cell-mediated anti-tumor immunity by targeting HIF-1α-PI3K/AKT/mTOR and CCL20 in hepatocellular carcinoma.
Journal: J Ethnopharmacol | Authors: Yang Liu | Species: mouse | Application: WB, IHC, IF - Nuclear Factor Erythroid 2-Related Factor 2 Activator DDO-1039 Ameliorates Podocyte Injury in Diabetic Kidney Disease via Suppressing Oxidative Stress, Inflammation, and Ferroptosis
Journal: Antioxid Redox Signal | Authors: Xing Liu | Application: WB - Yi-shen-hua-shi granules modulate immune and inflammatory damage via the ALG3/PPARγ/NF-κB pathway in the treatment of immunoglobulin a nephropathy
Journal: J Ethnopharmacol | Authors: Rongjia Xu | Species: rat | Application: WB - Differential immune responses of C57BL/6 mice to infection by Salmonella enterica serovar Typhimurium strain SL1344, CVCC541 and CMCC50115.
Journal: Virulence | Authors: Shao Wei | Species: mouse | Application: WB - Ganluyin ameliorates DSS-induced ulcerative colitis by inhibiting the enteric-origin LPS/TLR4/NF-κB pathway.
Journal: J Ethnopharmacol | Authors: Taoxiu Xiong | Species: mouse | Application: WB - The protective role of Cordyceps cicadae and its active ingredient Myriocin against sodium iodate-induced age-related macular degeneration via an anti-necroptotic TNF-RIPK1/3 pathway
Journal: J Ethnopharmacol | Authors: Shao-Zhuang Ma | Species: human | Application: WB - Huangqi-Danshen decoction alleviates renal fibrosis through targeting SCD1 to modulate cGAS/STING signaling
Journal: J Ethnopharmacol | Authors: Yu Peng | Species: mouse | Application: WB - Integration of single-cell RNA sequencing and network pharmacology to elucidate the effect of Yantiao Formula on alleviating ALI by regulating the polarization of alveolar macrophages
Journal: J Ethnopharmacol | Authors: Deng Liu | Species: rat | Application: WB - Evaluation of anti-hyperuricemic and nephroprotective activities and discovery of new XOD inhibitors of Morus alba L. root bark
Journal: J Ethnopharmacol | Authors: Yan-Ao Wang | Species: mouse | Application: WB - Chen's Jinshui Pills ameliorate diabetic retinopathy in mice and are associated with intestinal barrier protection and anti-inflammatory effects.
Journal: J Ethnopharmacol | Authors: Yang Jiang | Species: mouse | Application: WB - Yi-shen-hua-shi granules modulate immune and inflammatory damage via the ALG3/PPARγ/NF-κB pathway in the treatment of immunoglobulin a nephropathy
Journal: J Ethnopharmacol | Authors: Rongjia Xu | Species: rat | Application: WB - Uncovering the mechanisms of Zhubi decoction against rheumatoid arthritis through an integrated study of network pharmacology, metabolomics, and intestinal flora
Journal: J Ethnopharmacol | Authors: Jing Liu | Species: rat | Application: IF - Sanweidoukou Decoction, a Chinese herbal formula, ameliorates β-amyloid protein-induced neuronal insult via modulating MAPK/NF-κB signaling pathways: studies in vivo and in vitro.
Journal: J Ethnopharmacol | Authors: Feng-Mao An | Species: rat | Application: WB - Solidago decurrens Lour. controls LPS-induced acute lung injury by reducing inflammatory responses and modulating the TLR4/NF-κB/NLRP3 signaling pathway
Journal: J Ethnopharmacol | Authors: Dan-Yang Ma | Species: mouse | Application: WB - Bie-Jia-Jian Pill: Inhibiting tumor glycolysis and promoting CD8(+) cell-mediated anti-tumor immunity by targeting HIF-1α-PI3K/AKT/mTOR and CCL20 in hepatocellular carcinoma.
Journal: J Ethnopharmacol | Authors: Yang Liu | Species: mouse | Application: WB, IHC, IF - Chen's Jinshui Pills ameliorate diabetic retinopathy in mice and are associated with intestinal barrier protection and anti-inflammatory effects.
Journal: J Ethnopharmacol | Authors: Yang Jiang | Species: mouse | Application: WB - Oryzanol Attenuates High Fat and Cholesterol Diet-Induced Hyperlipidemia by Regulating the Gut Microbiome and Amino Acid Metabolism.
Journal: J Agric Food Chem | Authors: Sisi Yan | Application: WB - Injectable gelatin/oxidized dextran hydrogel loaded with apocynin for skin tissue regeneration
Journal: Biomater Adv | Authors: Shuaimeng Guan | Species: mouse | Application: WB - Inhibition of ADAM17: A New Therapeutic Strategy to Alleviate Zearalenone Toxin-Induced Liver Injury by Endoplasmic Reticulum Stress and Inflammation
Journal: J Agric Food Chem | Authors: Pengli Liu | Species: mouse | Application: WB - Polyphenol-Rich Extract from Litchi chinensis Seeds Alleviates Hypertension-Induced Renal Damage in Rats.
Journal: J Agric Food Chem | Authors: Yuan Yao | Species: rat | Application: WB - Astaxanthin Alleviated La(2)O(3) Nanoparticle-Induced Liver Injury by Activating the Transsulfuration Pathway in Mice.
Journal: J Agric Food Chem | Authors: Lu Yuan - Design, synthesis, and SAR study of novel flavone 1,2,4-oxadiazole derivatives with anti-inflammatory activities for the treatment of Parkinson's disease
Journal: Eur J Med Chem | Authors: Zhen-Bao Shen | Species: mouse | Application: WB - Pelargonidin-3-O-galactoside Alleviates Acute Lung Injury Induced by Klebsiella pneumoniae by Targeting CD38-Mediated Pyroptosis
Journal: J Agric Food Chem | Authors: Fei Jiang | Species: mouse | Application: WB - Ginsenoside Rk3 Treats Corneal Injury Through the HMGB1/TLR4/NF-κB Pathway
Journal: J Agric Food Chem | Authors: Linlin Qu | Species: mouse,human | Application: WB - Design, synthesis and evaluation of fused hybrids with acetylcholinesterase inhibiting and Nrf2 activating functions for Alzheimer's disease
Journal: Eur J Med Chem | Authors: Yuanyuan Wang | Species: mouse | Application: WB - Development of the core-shell nano-system and its application in infective endocarditis: A non-antibiotic therapeutic strategy.
Journal: Biomater Adv | Authors: Sishi Cai | Species: rat | Application: WB - Design, synthesis, and SAR study of novel flavone 1,2,4-oxadiazole derivatives with anti-inflammatory activities for the treatment of Parkinson's disease
Journal: Eur J Med Chem | Authors: Zhen-Bao Shen | Species: mouse | Application: WB - Purple Yam Polyphenol Extracts Exert Anticolitis and Anticolitis-Associated Colorectal Cancer Effects through Inactivation of NF-κB/p65 and STAT3 Signaling Pathways
Journal: J Agric Food Chem | Authors: Xinyue Yang | Species: mouse | Application: WB - Multimodal bioprinting of pigmented skin with algorithm-tuned control.
Journal: Biomater Adv | Authors: Rihui Kang | Species: mouse | Application: IF - Astaxanthin Alleviated La(2)O(3) Nanoparticle-Induced Liver Injury by Activating the Transsulfuration Pathway in Mice.
Journal: J Agric Food Chem | Authors: Lu Yuan - Nephroprotective Effects of Cardamonin on Renal Ischemia Reperfusion Injury/UUO-Induced Renal Fibrosis
Journal: J Agric Food Chem | Authors: Banghua Zhang | Species: mouse | Application: WB - Oryzanol Attenuates High Fat and Cholesterol Diet-Induced Hyperlipidemia by Regulating the Gut Microbiome and Amino Acid Metabolism.
Journal: J Agric Food Chem | Authors: Sisi Yan | Application: WB - Naringenin Inhibits Acid Sphingomyelinase-Mediated Membrane Raft Clustering to Reduce NADPH Oxidase Activation and Vascular Inflammation
Journal: J Agric Food Chem | Authors: Meng Ding | Species: human | Application: WB - Ginsenoside Rk3 Treats Corneal Injury Through the HMGB1/TLR4/NF-κB Pathway
Journal: J Agric Food Chem | Authors: Linlin Qu | Species: mouse,human | Application: WB - Aloin Attenuates Oxidative Stress, Inflammation, and CCl4-Induced Liver Fibrosis in Mice: Possible Role of TGF-β/Smad Signaling
Journal: J Agric Food Chem | Authors: Junjie Bai | Species: mouse | Application: WB - Design, synthesis, and SAR study of novel flavone 1,2,4-oxadiazole derivatives with anti-inflammatory activities for the treatment of Parkinson's disease
Journal: Eur J Med Chem | Authors: Zhen-Bao Shen | Species: mouse | Application: WB - H2S Donor SPRC Ameliorates Ischemic Stroke by Upregulating CD24
Journal: CNS Neurosci Ther | Authors: Chenye Wang | Species: mouse | Application: WB - Human umbilical cord mesenchymal stem cell-derived exosomes attenuate neuroinflammation and oxidative stress through the NRF2/NF-κB/NLRP3 pathway
Journal: CNS Neurosci Ther | Authors: Ji Che | Species: mouse | Application: WB - STING Activation in Macrophages and Microglia Drives Poststroke Inflammation: Implications for Neuroinflammatory Mechanisms and Therapeutic Interventions
Journal: CNS Neurosci Ther | Authors: Zhiruo Liu | Species: mouse | Application: IF - Effects of intraperitoneal injection of lipopolysaccharide-induced peripheral inflammation on dopamine neuron damage in rat midbrain.
Journal: CNS Neurosci Ther | Authors: Qiu-Yu Yang | Species: rat | Application: WB - Protective effect and mechanism of baicalin on lung inflammatory injury in BALB/cJ mice induced by PM2.5
Journal: Ecotoxicol Environ Saf | Authors: Lili Deng | Species: mouse | Application: WB - Chicken thalamic injury induced by copper (II) or / and arsenite exposure involves oxidative stress and inflammation-induced apoptosis.
Journal: Ecotoxicol Environ Saf | Authors: Dongxu Wang | Application: WB - Acrylamide exposure induces neurotoxicity via the PI3K/Akt/NF-κB pathway: Evidence from network toxicology and experimental validation.
Journal: Ecotoxicol Environ Saf | Authors: Zhaoda Duan | Species: mouse | Application: WB - The epigenetic regulator BRD4 is involved in cadmium-triggered inflammatory response in rat kidney.
Journal: Ecotoxicol Environ Saf | Authors: Zhonggui Gong | Species: rat | Application: WB - Elevated Level of Circulating Platelet-derived Microparticles in Oral Cancer.
Journal: J Dent Res | Authors: J G Ren | Species: human | Application: IHC - H2S Donor SPRC Ameliorates Ischemic Stroke by Upregulating CD24
Journal: CNS Neurosci Ther | Authors: Chenye Wang | Species: mouse | Application: WB - TBPH-induced lung injury is induced by mitochondrial-derived ds-DNA-mediated inflammatory response
Journal: Ecotoxicol Environ Saf | Authors: Baopeng Xing | Species: mouse | Application: WB,IF - The epigenetic regulator BRD4 is involved in cadmium-triggered inflammatory response in rat kidney.
Journal: Ecotoxicol Environ Saf | Authors: Zhonggui Gong | Species: rat | Application: WB - TBPH-induced lung injury is induced by mitochondrial-derived ds-DNA-mediated inflammatory response
Journal: Ecotoxicol Environ Saf | Authors: Baopeng Xing | Species: mouse | Application: WB,IF - Acrylamide exposure induces neurotoxicity via the PI3K/Akt/NF-κB pathway: Evidence from network toxicology and experimental validation.
Journal: Ecotoxicol Environ Saf | Authors: Zhaoda Duan | Species: mouse | Application: WB - Protective effect and mechanism of baicalin on lung inflammatory injury in BALB/cJ mice induced by PM2.5
Journal: Ecotoxicol Environ Saf | Authors: Lili Deng | Species: mouse | Application: WB - Inflammasome/NF-κB translocation inhibition via PPARγ agonist mitigates inorganic mercury induced nephrotoxicity.
Journal: Ecotoxicol Environ Saf | Authors: Siwen Li | Species: human | Application: WB - STING Activation in Macrophages and Microglia Drives Poststroke Inflammation: Implications for Neuroinflammatory Mechanisms and Therapeutic Interventions
Journal: CNS Neurosci Ther | Authors: Zhiruo Liu | Species: mouse | Application: IF - Synergistic effects of lipopolysaccharide and rotenone on dopamine neuronal damage in rats
Journal: CNS Neurosci Ther | Authors: Jing-Yi He | Species: rat | Application: WB - H2S Donor SPRC Ameliorates Ischemic Stroke by Upregulating CD24
Journal: CNS Neurosci Ther | Authors: Chenye Wang | Species: mouse | Application: WB - Inflammasome/NF-κB translocation inhibition via PPARγ agonist mitigates inorganic mercury induced nephrotoxicity.
Journal: Ecotoxicol Environ Saf | Authors: Siwen Li | Species: human | Application: WB - Acrylamide exposure induces neurotoxicity via the PI3K/Akt/NF-κB pathway: Evidence from network toxicology and experimental validation.
Journal: Ecotoxicol Environ Saf | Authors: Zhaoda Duan | Species: mouse | Application: WB - The epigenetic regulator BRD4 is involved in cadmium-triggered inflammatory response in rat kidney.
Journal: Ecotoxicol Environ Saf | Authors: Zhonggui Gong | Species: rat | Application: WB - Dauricine regulates prostate cancer progression by inhibiting PI3K/AKT-dependent M2 polarization of macrophages
Journal: Biochem Pharmacol | Authors: Mengxuan Li | Species: mouse,human | Application: WB - An increase in Semaphorin 3A biases the axonal direction and induces an aberrant dendritic arborization in an in vitro model of human neural progenitor differentiation
Journal: Cell Biosci | Authors: Gabriella Ferretti | Species: human | Application: WB - Alda-1, an activator of ALDH2, ameliorates Achilles tendinopathy in cellular and mouse models.
Journal: Biochem Pharmacol | Authors: Yu-Chuan Liu | Species: mouse | Application: WB,IHC - CX3CL1/CX3CR1 axis dysregulation contributes to epileptogenic mechanisms in focal cortical dysplasia.
Journal: Acta Neuropathol Commun | Authors: Lei Lei | Species: rat | Application: WB - MYH11 upregulation attenuates autophagy dysfunction through modulation of ATG4A in metabolic dysfunction-associated steatotic liver disease.
Journal: Biochem Pharmacol | Authors: Guang-Peng Liu - Soluble guanylate cyclase stimulator vericiguat alleviates skeletal muscle injury and exercise capacity decline in ApoE(-/-) mice by inhibiting oxidative stress and repairing mitophagy.
Journal: Biochem Pharmacol | Authors: Yu-Lin Li | Species: mouse | Application: IHC - The Biomarker TCONS_00016233 Drives Septic AKI by Targeting the miR-22-3p/AIFM1 Signaling Axis.
Journal: Mol Ther Nucleic Acids | Authors: Pan Zhang | Species: human | Application: WB - MYH11 upregulation attenuates autophagy dysfunction through modulation of ATG4A in metabolic dysfunction-associated steatotic liver disease.
Journal: Biochem Pharmacol | Authors: Guang-Peng Liu - CX3CL1/CX3CR1 axis dysregulation contributes to epileptogenic mechanisms in focal cortical dysplasia.
Journal: Acta Neuropathol Commun | Authors: Lei Lei | Species: rat | Application: WB - β - sitosterol promotes the SUMOylation of DRP1 in alveolar macrophages and alleviates sepsis-associated acute lung injury.
Journal: Biochem Pharmacol | Authors: Bailun Wang | Species: mouse | Application: IHC - Soluble guanylate cyclase stimulator vericiguat alleviates skeletal muscle injury and exercise capacity decline in ApoE(-/-) mice by inhibiting oxidative stress and repairing mitophagy.
Journal: Biochem Pharmacol | Authors: Yu-Lin Li | Species: mouse | Application: IHC - An increase in Semaphorin 3A biases the axonal direction and induces an aberrant dendritic arborization in an in vitro model of human neural progenitor differentiation
Journal: Cell Biosci | Authors: Gabriella Ferretti | Species: human | Application: WB - Ginsenoside Rg1 alleviates MASH by targeting GLS2 to enhance PINK1/Parkin-mediated mitophagy and improve mitochondrial function.
Journal: Biochem Pharmacol | Authors: Zhijian Wang | Species: mouse | Application: WB - Ginsenoside Rg1 alleviates MASH by targeting GLS2 to enhance PINK1/Parkin-mediated mitophagy and improve mitochondrial function.
Journal: Biochem Pharmacol | Authors: Zhijian Wang | Species: mouse | Application: WB - Divergent mechanisms, unified therapy: saracatinib targets Src/HIF signaling in endothelial and microglial cells to treat retinopathy.
Journal: Biochem Pharmacol | Authors: Hu Qiang | Species: mouse,human | Application: IF - Fecal microbiota transplantation promotes hair growth through gut microbiome and metabolic regulation
Journal: Life Sci | Authors: Yangyang Tian - Progranulin (PGRN) Facilitates Anti-Inflammation and Pulpitis Repair In Vivo and In Vitro Through TNFR2/14-3-3ε Signalling Complex
Journal: Int Endod J | Authors: Jinhong Ju | Species: rat | Application: IHC - BMSC-derived exosomes alleviate smoke inhalation lung injury through blockade of the HMGB1/NF-κB pathway.
Journal: Life Sci | Authors: Bin Xu | Species: rat | Application: WB - Chlorogenic acid attenuates cyclophosphamide-induced rat interstitial cystitis.
Journal: Life Sci | Authors: Jing Luo | Species: rat | Application: WB,IHC - Lycopene inhibits doxorubicin-induced heart failure by inhibiting ferroptosis through the Nrf2 signaling pathway
Journal: Life Sci | Authors: Rong Huang | Species: mouse | Application: WB - Hic-5 deficiency attenuates hepatic ischemia reperfusion injury through TLR4/NF-κB signaling pathways.
Journal: Life Sci | Authors: Lin Gao | Species: mouse | Application: WB - Therapeutic effects of kefir peptides on adjuvant-induced arthritis in rats through anti-inflammation and downregulation of matrix metalloproteinases
Journal: Life Sci | Authors: Kai-Cheng Chuang | Species: rat | Application: WB - Role of SIRT2 in intestinal barrier under cold exposure
Journal: Life Sci | Authors: Jingru Guo | Species: mouse | Application: WB - BMSC-derived exosomes alleviate smoke inhalation lung injury through blockade of the HMGB1/NF-κB pathway.
Journal: Life Sci | Authors: Bin Xu | Species: rat | Application: WB - Melatonin protects circulatory death heart from ischemia/reperfusion injury via the JAK2/STAT3 signalling pathway.
Journal: Life Sci | Authors: Hongwen Lan | Species: rat | Application: WB - Lycopene inhibits doxorubicin-induced heart failure by inhibiting ferroptosis through the Nrf2 signaling pathway
Journal: Life Sci | Authors: Rong Huang | Species: mouse | Application: WB - Melatonin protects circulatory death heart from ischemia/reperfusion injury via the JAK2/STAT3 signalling pathway.
Journal: Life Sci | Authors: Hongwen Lan | Species: rat | Application: WB - Role of SIRT2 in intestinal barrier under cold exposure
Journal: Life Sci | Authors: Jingru Guo | Species: mouse | Application: WB - Chlorogenic acid attenuates cyclophosphamide-induced rat interstitial cystitis.
Journal: Life Sci | Authors: Jing Luo | Species: rat | Application: WB,IHC - TLR4 knockout upregulates the expression of Mfn2 and PGC-1α in a high-fat diet and ischemia-reperfusion mice model of liver injury.
Journal: Life Sci | Authors: Chaoyang Zhang | Species: mouse | Application: WB - Betaine supplementation alleviates dextran sulfate sodium-induced colitis via regulating the inflammatory response, enhancing the intestinal barrier, and altering gut microbiota
Journal: Food Funct | Authors: Nannan Zhao | Species: mouse | Application: WB - Hypouricemic and renal protective effects of the Chinese functional tea Ligustrum robustum on hyperuricemic mice.
Journal: Food Funct | Authors: Xiao-Long Tian | Species: mouse | Application: WB - Curcumin inhibits cigarette smoke-induced inflammation via modulating the PPARγ-NF-κB signaling pathway
Journal: Food Funct | Authors: Qiuping Li | Species: human | Application: WB - Yolk extract-derived vitellogenin 2 ameliorates muscle atrophy in mice via the PI3K/AKT/mTOR pathway.
Journal: Food Funct | Authors: Yilei Li | Species: mouse | Application: WB - Neuroprotective effects of macamide from maca (Lepidium meyenii Walp.) on corticosterone-induced hippocampal impairments through its anti-inflammatory, neurotrophic, and synaptic protection properties.
Journal: Food Funct | Authors: Zejun Yu | Species: rat | Application: WB - Combination of inorganic nitrate and vitamin C prevents collagen-induced arthritis in rats by inhibiting pyroptosis
Journal: Food Funct | Authors: Haoyang Zhang | Species: rat,human | Application: WB - Chrysanthemum 3,5-O-dicaffeoylquinic acid ameliorates mouse alcoholic liver injury by suppressing the TLR-4/NF-κB pathway and restoring glycerophospholipid homeostasis.
Journal: Food Funct | Authors: Yi-Long Ma | Species: mouse | Application: WB - Curcumin inhibits cigarette smoke-induced inflammation via modulating the PPARγ-NF-κB signaling pathway
Journal: Food Funct | Authors: Qiuping Li | Species: human | Application: WB - Betaine supplementation alleviates dextran sulfate sodium-induced colitis via regulating the inflammatory response, enhancing the intestinal barrier, and altering gut microbiota
Journal: Food Funct | Authors: Nannan Zhao | Species: mouse | Application: WB - Chrysanthemum 3,5-O-dicaffeoylquinic acid ameliorates mouse alcoholic liver injury by suppressing the TLR-4/NF-κB pathway and restoring glycerophospholipid homeostasis.
Journal: Food Funct | Authors: Yi-Long Ma | Species: mouse | Application: WB - Yolk extract-derived vitellogenin 2 ameliorates muscle atrophy in mice via the PI3K/AKT/mTOR pathway.
Journal: Food Funct | Authors: Yilei Li | Species: mouse | Application: WB - Blackcurrant polyphenol extract improves alcoholic liver disease through the FGF21-NET/c-FOS pathway.
Journal: Food Funct | Authors: Manjun Zhao | Species: mouse | Application: WB - Luteolin modulates liver macrophage subtype polarization and play protective role in sepsis induced acute hepatic injury
Journal: Inflamm Res | Authors: Liangyong Deng | Species: mouse | Application: IHC - PGC1α alleviates M1 macrophage polarization through dual regulation of succinate metabolism and TRAF5 expression to mitigate TLR4/NF-κB-driven inflammatory cascades and myocardial ischemia/reperfusion injury.
Journal: Inflamm Res | Authors: Jiajie Leng | Species: mouse | Application: WB - Two-electron oxidized polyphenol chemistry-inspired superhydrophilic drug-carrying coatings for the construction of multifunctional nasolacrimal duct stents.
Journal: J Mater Chem B | Authors: Wenzhe Xiao | Species: mouse | Application: WB - Luteolin modulates liver macrophage subtype polarization and play protective role in sepsis induced acute hepatic injury
Journal: Inflamm Res | Authors: Liangyong Deng | Species: mouse | Application: IHC - Quercetin and Kaempferol inhibit HMC-1 activation via SOCE/NFATc2 signaling and suppress hippocampal mast cell activation in lipopolysaccharide-induced depressive mice
Journal: Inflamm Res | Authors: Pan Su | Species: human | Application: WB - Methylmalonic acid as a ferroptosis-derived danger signal: activation of the PI3K-NF-κB pathway drives M1 macrophage polarization in renal ischemia-reperfusion injury.
Journal: Inflamm Res | Authors: Huimeng Wang - Lp-PLA2-derived LysoPC drives dendritic cell immunogenic activation and Th17 inflammation in severe asthma.
Journal: Inflamm Res | Authors: Fang Wang | Species: mouse | Application: WB - CPB@PLH NPs accelerate wound healing by antibacterial and anti-inflammatory effects.
Journal: RSC Adv | Authors: Yilong Li | Species: mouse | Application: IHC - Injectable shear-thinning polylysine hydrogels for localized immunotherapy of gastric cancer through repolarization of tumor-associated macrophages
Journal: Biomater Sci | Authors: Yan Yang | Species: mouse | Application: IHC - Activation of Hippocampal ACE2 Prevents the Dysbiosis-induced Depression-like Behavior in Mice by Enhanced Neurogenesis and Neuroprotection via Mas Receptor.
Journal: J Neuroimmune Pharmacol | Authors: Minoru Tsuji | Species: mouse | Application: WB - Mangiferin and oleocanthal in the modulation of oxidative stress in monocytes and macrophages.
Journal: RSC Adv | Authors: Richa Sharma | Species: human | Application: WB - Role of Aberrantly Activated Lysophosphatidic Acid Receptor 1 Signaling Mediated Inflammation in Renal Aging.
Journal: Cells | Authors: Yongjie Jin | Species: mouse,human | Application: WB - L-Se-methylselenocysteine loaded mucoadhesive thermogel for effective treatment of Vulvar candidiasis.
Journal: Int J Pharm | Authors: Xianwei Yang | Species: rat | Application: IHC - Toll-Like Receptor 9 Plays a Pivotal Role in Angiotensin II-Induced Atherosclerosis.
Journal: J Am Heart Assoc | Authors: Daiju Fukuda - Effect of dihydromyricetin on hepatic encephalopathy associated with acute hepatic failure in mice.
Journal: Pharm Biol | Authors: Long Cheng | Species: mouse | Application: WB - Role of Aberrantly Activated Lysophosphatidic Acid Receptor 1 Signaling Mediated Inflammation in Renal Aging.
Journal: Cells | Authors: Yongjie Jin | Species: mouse,human | Application: WB - Human FGF1(ΔHBS) Gene Therapy as Treatment for Metabolic Dysfunction-Associated Steatohepatitis in ApoE-KO Mice.
Journal: Cells | Authors: Yingjian Li | Species: mouse | Application: IHC - The Clostridium Metabolite P-Cresol Sulfate Relieves Inflammation of Primary Biliary Cholangitis by Regulating Kupffer Cells
Journal: Cells | Authors: Hai-Yan Fu | Species: mouse | Application: WB - Ubiquitinome Analysis Uncovers Alterations in Synaptic Proteins and Glucose Metabolism Enzymes in the Hippocampi of Adolescent Mice Following Cold Exposure
Journal: Cells | Authors: Xin-Yue Li | Species: mouse | Application: WB - Catalpol relieved angiotensin II-induced blood–brain barrier destruction via inhibiting the TLR4 pathway in brain endothelial cells
Journal: Pharm Biol | Authors: Yu Xia | Species: mouse | Application: WB - L-Se-methylselenocysteine loaded mucoadhesive thermogel for effective treatment of Vulvar candidiasis.
Journal: Int J Pharm | Authors: Xianwei Yang | Species: rat | Application: IHC - Effect of dihydromyricetin on hepatic encephalopathy associated with acute hepatic failure in mice.
Journal: Pharm Biol | Authors: Long Cheng | Species: mouse | Application: WB - Toll-Like Receptor 9 Plays a Pivotal Role in Angiotensin II-Induced Atherosclerosis.
Journal: J Am Heart Assoc | Authors: Daiju Fukuda - Human FGF1(ΔHBS) Gene Therapy as Treatment for Metabolic Dysfunction-Associated Steatohepatitis in ApoE-KO Mice.
Journal: Cells | Authors: Yingjian Li | Species: mouse | Application: IHC - Ubiquitinome Analysis Uncovers Alterations in Synaptic Proteins and Glucose Metabolism Enzymes in the Hippocampi of Adolescent Mice Following Cold Exposure
Journal: Cells | Authors: Xin-Yue Li | Species: mouse | Application: WB - Catalpol relieved angiotensin II-induced blood–brain barrier destruction via inhibiting the TLR4 pathway in brain endothelial cells
Journal: Pharm Biol | Authors: Yu Xia | Species: mouse | Application: WB - Effects of polysaccharide from Physalis alkekengi var. francheti on liver injury and intestinal microflora in type-2 diabetic mice.
Journal: Pharm Biol | Authors: Xin Zhao | Species: mouse | Application: WB - Ubiquitinome Analysis Uncovers Alterations in Synaptic Proteins and Glucose Metabolism Enzymes in the Hippocampi of Adolescent Mice Following Cold Exposure
Journal: Cells | Authors: Xin-Yue Li | Species: mouse | Application: WB - Silencing of lncRNA MIAT alleviates LPS-induced pneumonia via regulating miR-147a/NKAP/NF-κB axis.
Journal: Aging (Albany NY) | Authors: Min Liu | Species: human | Application: WB - The effect of swimming exercise and diet on the hypothalamic inflammation of ApoE-/- mice based on SIRT1-NF-κB-GnRH expression.
Journal: Aging (Albany NY) | Authors: Xialei Wang | Species: mouse | Application: WB - L-3-n-butylphthalide attenuates inflammation response and brain edema in rat intracerebral hemorrhage model.
Journal: Aging (Albany NY) | Authors: Zhou Zeng | Species: rat | Application: WB - α-Cyperone (CYP) down-regulates NF-κB and MAPKs signaling, attenuating inflammation and extracellular matrix degradation in chondrocytes, to ameliorate osteoarthritis in mice.
Journal: Aging (Albany NY) | Authors: Huawei Zhang | Application: WB - Dual Effects: Intrastriatal Injection of α-syn N103/tau N368 Preformed Fibrils Promotes Endogenous α-synuclein Aggregates in the Proximal Colon
Journal: J Parkinsons Dis | Authors: Jialing Wang | Species: rat | Application: WB - Self-assembled and dynamic bond crosslinked herb-polysaccharide hydrogel with anti-inflammation and pro-angiogenesis effects for burn wound healing
Journal: Colloids Surf B Biointerfaces | Authors: Hongfu Wu | Application: IHC - Evaluation of Natural Polyphenols Encapsulated in Multiparticulate Drug Delivery Systems as Potential Therapeutics for Cutaneous Melanoma.
Journal: J Funct Biomater | Authors: Andreea D. Lazar (Popa) | Species: human | Application: IF - A glycopeptide-based pH-responsive hydrogel promotes diabetic wound healing via antimicrobial and remodeling microenvironment
Journal: Colloids Surf B Biointerfaces | Authors: Hailong Xie | Application: IF - Biomimetic NO Scavenging Hyaluronic Acid Nanoparticles Enable Targeted Delivery of MTX and Integrated Management of Rheumatoid Arthritis
Journal: Biomacromolecules | Authors: Yilin Liu | Species: mouse | Application: WB - The Assessment on Synergistic Activity of Ebselen and Silver Ion Against Yersinia pseudotuberculosis
Journal: Front Microbiol | Authors: Chuanjiang Dong | Species: mouse | Application: IHC - Antibacterial and antioxidant phlorizin-loaded nanofiber film effectively promotes the healing of burn wounds
Journal: Front Bioeng Biotechnol | Authors: Ying Yang | Species: mouse | Application: WB - Effect and mechanism of Plantaginis Semen polysaccharides on intestinal microecology in rats with hyperuricemia
Journal: Front Microbiol | Authors: Jing Zhao | Species: rat | Application: WB - Sustained-Release Microneedles for Local Delivery of Antibacterial Peptide in Acne Therapy.
Journal: Polymers (Basel) | Authors: Jingyu Gao | Species: mouse | Application: IHC - Treadmill Exercise Modulates Intestinal Microbes and Suppresses LPS Displacement to Alleviate Neuroinflammation in the Brains of APP/PS1 Mice
Journal: Nutrients | Authors: Shunling Yuan | Species: mouse | Application: IF - Luteolin Alleviates Ulcerative Colitis in Mice by Modulating Gut Microbiota and Plasma Metabolism
Journal: Nutrients | Authors: Shuai Yang | Species: mouse | Application: WB - Luteolin Alleviates Ulcerative Colitis in Mice by Modulating Gut Microbiota and Plasma Metabolism
Journal: Nutrients | Authors: Shuai Yang | Species: mouse | Application: WB - The injury effect of osteopontin in sepsis-associated lung injury
Journal: J Inflamm (Lond) | Authors: Qian Wang | Species: mouse | Application: WB - Selenomethionine Suppressed TLR4/NF-κB Pathway by Activating Selenoprotein S to Alleviate ESBL Escherichia coli-Induced Inflammation in Bovine Mammary Epithelial Cells and Macrophages.
Journal: Front Microbiol | Authors: Cuicui Zhuang | Species: mouse | Application: WB - Electroacupuncture activates the TET1/PPARα pathway to protect mitochondrial function in MASLD.
Journal: J Inflamm (Lond) | Authors: Shurui Yang | Species: mouse | Application: WB - Lactobacillus paragasseri LPG-9 reduces placental inflammation in intrahepatic cholestasis of pregnancy by regulating TGR5 in mice.
Journal: Commun Biol | Authors: Wanwen Huang | Species: human | Application: WB - Engineered exosomes derived from miR-132-overexpresssing adipose stem cells promoted diabetic wound healing and skin reconstruction
Journal: Front Bioeng Biotechnol | Authors: Lifeng Ge | Species: mouse | Application: IHC - Engineered exosomes derived from miR-132-overexpresssing adipose stem cells promoted diabetic wound healing and skin reconstruction
Journal: Front Bioeng Biotechnol | Authors: Lifeng Ge | Species: mouse | Application: IHC - Electroacupuncture activates the TET1/PPARα pathway to protect mitochondrial function in MASLD.
Journal: J Inflamm (Lond) | Authors: Shurui Yang | Species: mouse | Application: WB - Sustained-Release Microneedles for Local Delivery of Antibacterial Peptide in Acne Therapy.
Journal: Polymers (Basel) | Authors: Jingyu Gao | Species: mouse | Application: IHC - Rosa roxburghii fermented juice mitigates LPS-induced acute lung injury by modulation of intestinal flora and metabolites
Journal: Front Microbiol | Authors: Zhiyu Chen | Species: mouse | Application: WB - Rat tight junction proteins are disrupted after subchronic exposure to okadaic acid
Journal: Environ Sci Pollut Res Int | Authors: Lu Huang | Species: rat | Application: IHC - Polyvinylpyrrolidone-Modified Taxifolin Liposomes Promote Liver Repair by Modulating Autophagy to Inhibit Activation of the TLR4/NF-κB Signaling Pathway.
Journal: Front Bioeng Biotechnol | Authors: Qiteng Ding | Species: mouse | Application: WB - Adipose-derived stem cell exosomes promote tumor characterization and immunosuppressive microenvironment in breast cancer
Journal: Cancer Immunol Immunother | Authors: Qin Zhu | Species: human | Application: WB - Treadmill Exercise Modulates Intestinal Microbes and Suppresses LPS Displacement to Alleviate Neuroinflammation in the Brains of APP/PS1 Mice
Journal: Nutrients | Authors: Shunling Yuan | Species: mouse | Application: IF - Selenomethionine Suppressed TLR4/NF-κB Pathway by Activating Selenoprotein S to Alleviate ESBL Escherichia coli-Induced Inflammation in Bovine Mammary Epithelial Cells and Macrophages.
Journal: Front Microbiol | Authors: Cuicui Zhuang | Species: mouse | Application: WB - Sustained-Release Microneedles for Local Delivery of Antibacterial Peptide in Acne Therapy.
Journal: Polymers (Basel) | Authors: Jingyu Gao | Species: mouse | Application: IHC - Akkermansia muciniphila promotes type H vessels formation and bone fracture healing by reducing gut permeability and inflammation
Journal: Dis Model Mech | Authors: Jiang-Hua Liu | Species: mouse | Application: IHC - Diacylated anthocyanins from purple sweet potato (Ipomoeabatatas L.) attenuate hyperglycemia and hyperuricemia in mice induced by a high-fructose/high-fat diet
Journal: J Zhejiang Univ Sci B | Authors: Luhong Shen | Species: mouse | Application: IHC - Oroxin B alleviates osteoarthritis through anti-inflammation and inhibition of PI3K/AKT/mTOR signaling pathway and enhancement of autophagy
Journal: Front Endocrinol (Lausanne) | Authors: Rui Lu | Species: mouse | Application: WB - Luteolin from Gastrodia elata Ameliorates Solar Dermatitis via Inhibition of the MAPK/JUN Signalling Pathway.
Journal: Pharmaceuticals (Basel) | Authors: Yewei Huang - Low-intensity pulsed ultrasound ameliorates angiotensin II-induced cardiac fibrosis by alleviating inflammation via a caveolin-1-dependent pathway.
Journal: J Zhejiang Univ Sci B | Authors: Kun Zhao | Species: rat | Application: WB - Steroid Constituents of Solidago canadensis alleviate LPS-induced inflammation via AMPK regulated Mitophagy/NLRP3 and NF-κB pathway
Journal: Eur J Pharmacol | Authors: Wenying Yin | Species: mouse | Application: WB - Potential Molecular Mechanism of Illicium simonsii Maxim Petroleum Ether Fraction in the Treatment of Hepatocellular Carcinoma
Journal: Pharmaceuticals (Basel) | Authors: Sihua Zou | Species: human | Application: WB - Exploring the Mechanism of Asiatic Acid against Atherosclerosis Based on Molecular Docking, Molecular Dynamics, and Experimental Verification
Journal: Pharmaceuticals (Basel) | Authors: Zhihao Wu | Species: mouse | Application: WB - Exploring the Mechanism of Asiatic Acid against Atherosclerosis Based on Molecular Docking, Molecular Dynamics, and Experimental Verification
Journal: Pharmaceuticals (Basel) | Authors: Zhihao Wu | Species: mouse | Application: WB - A Novel Mast Cell Stabilizer JM25-1 Rehabilitates Impaired Gut Barrier by Targeting the Corticotropin-Releasing Hormone Receptors
Journal: Pharmaceuticals (Basel) | Authors: Yueshan Sun | Species: rat,human | Application: WB,IHC - Low-intensity pulsed ultrasound ameliorates angiotensin II-induced cardiac fibrosis by alleviating inflammation via a caveolin-1-dependent pathway.
Journal: J Zhejiang Univ Sci B | Authors: Kun Zhao | Species: rat | Application: WB - Cigarette smoke exposed airway epithelial cell-derived EVs promote pro-inflammatory macrophage activation in alpha-1 antitrypsin deficiency
Journal: Respir Res | Authors: Nazli Khodayari | Species: human | Application: WB - Imperatorin attenuates CCl4-induced cirrhosis and portal hypertension by improving vascular remodeling and profibrogenic pathways
Journal: Eur J Pharmacol | Authors: Zhifeng Zhao | Species: rat | Application: WB - Steroid Constituents of Solidago canadensis alleviate LPS-induced inflammation via AMPK regulated Mitophagy/NLRP3 and NF-κB pathway
Journal: Eur J Pharmacol | Authors: Wenying Yin | Species: mouse | Application: WB - Steroid Constituents of Solidago canadensis alleviate LPS-induced inflammation via AMPK regulated Mitophagy/NLRP3 and NF-κB pathway
Journal: Eur J Pharmacol | Authors: Wenying Yin | Species: mouse | Application: WB - Cigarette smoke exposed airway epithelial cell-derived EVs promote pro-inflammatory macrophage activation in alpha-1 antitrypsin deficiency
Journal: Respir Res | Authors: Nazli Khodayari | Species: human | Application: WB - Imperatorin attenuates CCl4-induced cirrhosis and portal hypertension by improving vascular remodeling and profibrogenic pathways
Journal: Eur J Pharmacol | Authors: Zhifeng Zhao | Species: rat | Application: WB - Luteolin from Gastrodia elata Ameliorates Solar Dermatitis via Inhibition of the MAPK/JUN Signalling Pathway.
Journal: Pharmaceuticals (Basel) | Authors: Yewei Huang - Iguratimod decreases bleomycin-induced pulmonary fibrosis in association with inhibition of TNF-α in mice.
Journal: Int Immunopharmacol | Authors: Siqi Shao | Species: mouse | Application: WB - Protective effects of levo-tetrahydropalmatine on hepatic ischemia/reperfusion injury are mediated by inhibition of the ERK/NF-κB pathway.
Journal: Int Immunopharmacol | Authors: Qiang Yu | Species: mouse | Application: WB - Wogonin inhibits the growth of HT144 melanoma via regulating hedgehog signaling-mediated inflammation and glycolysis.
Journal: Int Immunopharmacol | Authors: Ling Li | Species: human | Application: WB - ACOD1 mediates Staphylococcus aureus-induced inflammatory response via the TLR4/NF-κB signaling pathway
Journal: Int Immunopharmacol | Authors: Fan Dai | Species: mouse | Application: WB - Syringin exerts neuroprotective effects in a rat model of cerebral ischemia through the FOXO3a/NF-κB pathway.
Journal: Int Immunopharmacol | Authors: Junyi Tan | Species: rat | Application: WB - Rice Protein Exerts Anti-Inflammatory Effect in Growing and Adult Rats via Suppressing NF-κB Pathway.
Journal: Int J Mol Sci | Authors: Zhengxuan Wang | Species: rat | Application: WB - Oroxylin A inhibits carcinogen-induced skin tumorigenesis through inhibition of inflammation by regulating SHCBP1 in mice.
Journal: Int Immunopharmacol | Authors: Hongjuan Huang | Species: mouse | Application: WB - Vitamin D against diabetic adipose tissue inflammation through SHP-1/STAT3 pathway
Journal: Int Immunopharmacol | Authors: Xiaonuo Wei - CX3CR1/P2X4R signaling-mediated spinal microglial M1 polarization contributes to chronic pelvic pain in endometriosis.
Journal: Int Immunopharmacol | Authors: Qiong Wu | Species: mouse,human | Application: WB - Multi-Omics and Experimental Validation Reveal the Protective Effect of Paeoniflorin Against Coronary Heart Disease in Mice via Inhibiting the C3-Cfd-C3aR Pathway.
Journal: Int J Mol Sci | Authors: Ying Yang - Artesunate attenuates atherosclerosis by inhibiting macrophage M1-like polarization and improving metabolism.
Journal: Int Immunopharmacol | Authors: Xiaoxu Wang | Species: mouse | Application: WB - PSMB4/MHC-I Signaling in the Cerebrospinal Fluid-Contacting Nucleus Mediates Neuroinflammatory Depression in Mice.
Journal: Int J Mol Sci | Authors: Yi-Jun Zhang | Species: mouse | Application: WB - Copper and arsenic-induced oxidative stress and immune imbalance are associated with activation of heat shock proteins in chicken intestines.
Journal: Int Immunopharmacol | Authors: Yu Wang | Application: WB - Berberine combined with cyclosporine A alleviates acute graft-versus-host disease in murine models.
Journal: Int Immunopharmacol | Authors: Meng Wang | Species: mouse | Application: WB - Anethole trithione mitigates LPS/D-Gal-induced acute liver injury by suppressing ROS production and NF-κB activity
Journal: Int Immunopharmacol | Authors: Zhen He | Species: human | Application: WB - Protective effects of levo-tetrahydropalmatine on hepatic ischemia/reperfusion injury are mediated by inhibition of the ERK/NF-κB pathway.
Journal: Int Immunopharmacol | Authors: Qiang Yu | Species: mouse | Application: WB - Oroxylin A inhibits carcinogen-induced skin tumorigenesis through inhibition of inflammation by regulating SHCBP1 in mice.
Journal: Int Immunopharmacol | Authors: Hongjuan Huang | Species: mouse | Application: WB - ACOD1 mediates Staphylococcus aureus-induced inflammatory response via the TLR4/NF-κB signaling pathway
Journal: Int Immunopharmacol | Authors: Fan Dai | Species: mouse | Application: WB - SAL protects endothelial cells from H(2)O(2)-induced endothelial dysfunction: Regulation of inflammation and autophagy by EZH2.
Journal: Int Immunopharmacol | Authors: Li Sun | Species: human | Application: WB - Role of Adiponectin in Regulating Cytokines and Its Contribution to the Occurrence and Progression of Clinical Mastitis in Holstein Cows
Journal: Int J Mol Sci | Authors: Junjun Zhang - Jatrorrhizine retard obesity by modulating transcription factor c-Jun/c-Fos to downregulate Mmp12-mediated inflammation
Journal: Int Immunopharmacol | Authors: Zhengcai Ma | Species: mouse | Application: WB - Gastrodin against oxidative stress-inflammation crosstalk via inhibiting mtDNA/TLR9 and JAK2/STAT3 signaling to ameliorate ischemic stroke injury
Journal: Int Immunopharmacol | Authors: Menglian Zhang | Application: WB - GABA-mediated activated microglia induce neuroinflammation in the hippocampus of mice following cold exposure through the NLRP3 inflammasome and NF-κB signaling pathways.
Journal: Int Immunopharmacol | Authors: Limin Lang | Species: mouse | Application: WB - Therapeutic Effects of Glycyrrhizic Acid on Dry Eye Disease: Targeting Pyroptosis, Oxidative Stress, and Epithelial Barrier Dysfunction.
Journal: Int J Mol Sci | Authors: Yiran Chu | Species: mouse,human | Application: WB - Anethole trithione mitigates LPS/D-Gal-induced acute liver injury by suppressing ROS production and NF-κB activity
Journal: Int Immunopharmacol | Authors: Zhen He | Species: human | Application: WB - The ASB@HNTs-PVA nanofiber membrane, possessing both anti-inflammatory and hemostatic activities, promotes the healing of T2D skin wounds
Journal: Int Immunopharmacol | Authors: Yan Tang | Species: human | Application: WB - Berberine combined with cyclosporine A alleviates acute graft-versus-host disease in murine models.
Journal: Int Immunopharmacol | Authors: Meng Wang | Species: mouse | Application: WB - Atractylenolide-III attenuates osteoarthritis by repolarizing macrophages through inactivating TLR4/NF-κB signaling
Journal: Int Immunopharmacol | Authors: Guoliang Yi | Species: rat | Application: IHC - Ulinastatin ameliorates preeclampsia induced by N(gamma)-nitro-l-arginine methyl ester in a rat model via inhibition of the systemic and placental inflammatory response
Journal: J Hypertens | Authors: Zhiqiang Yu | Species: rat | Application: WB - Click-Chemistry-Based Antibacterial Hybrid Hydrogel with Sustained Puerarin Release for Diabetic Wound Healing.
Journal: ACS Appl Bio Mater | Authors: Shuangyan Jiang - The Role of Apoptosis and Autophagy in the Hypothalamic-Pituitary-Adrenal (HPA) Axis after Traumatic Brain Injury (TBI)
Journal: Int J Mol Sci | Authors: Serpil Taheri | Species: rat | Application: WB - SAL protects endothelial cells from H(2)O(2)-induced endothelial dysfunction: Regulation of inflammation and autophagy by EZH2.
Journal: Int Immunopharmacol | Authors: Li Sun | Species: human | Application: WB - Sinomenine contributes to the inhibition of the inflammatory response and the improvement of osteoarthritis in mouse-cartilage cells by acting on the Nrf2/HO-1 and NF-κB signaling pathways.
Journal: Int Immunopharmacol | Authors: Yifan Wu | Species: mouse | Application: WB - Hypoxia-Induced Extracellular Vesicles Derived from Human Umbilical Cord Mesenchymal Stem Cells Regulate Macrophage Polarization and Enhance Angiogenesis to Promote Diabetic Wound Healing.
Journal: Biomolecules | Authors: Yongfeng Su | Species: rat | Application: IHC,IF - Picrorhiza scrophulariiflora ethanol extract ameliorates CCl(4)-induced acute liver injury by blocking the TSP1/TNF/NF-κB axis.
Journal: Int Immunopharmacol | Authors: Menghao Li | Species: mouse,human | Application: WB - Interleukin-37 ameliorates atherosclerosis by regulating autophagy-mediated endothelial cell apoptosis and inflammation
Journal: Int Immunopharmacol | Authors: Shengyang Xiao | Species: mouse | Application: IHC - The ASB@HNTs-PVA nanofiber membrane, possessing both anti-inflammatory and hemostatic activities, promotes the healing of T2D skin wounds
Journal: Int Immunopharmacol | Authors: Yan Tang | Species: human | Application: WB - Chronic Intermittent Hypoxia Exacerbates High-Fat Diet-Induced MASLD Through Lipid Metabolic Reprogramming, Impaired Antioxidant Defense, and NF-κB/NLRP3 Activation.
Journal: Biomolecules | Authors: Lisong Ye | Species: mouse | Application: WB - Integrated Network Pharmacology and Gut Microbiota Analysis Reveals the Alcoholic Extract of Anacyclus pyrethrum Root Prevents Nonalcoholic Fatty Liver Disease via the LPS/TLR4/NF-κB Pathway.
Journal: Int J Mol Sci | Authors: Hao Yang | Species: mouse | Application: WB - The ASB@HNTs-PVA nanofiber membrane, possessing both anti-inflammatory and hemostatic activities, promotes the healing of T2D skin wounds
Journal: Int Immunopharmacol | Authors: Yan Tang | Species: human | Application: WB - FXR-mediated transcriptional regulation of KLF11 mitigates contrast-induced acute kidney injury via suppressing JAK2/STAT3 pathway.
Journal: Int Immunopharmacol | Authors: Bo-Wei Su | Species: mouse,human | Application: WB, IHC, IF - IL-17 enhanced the susceptibility to fluoxetine resistance in depression via the JAK1-STAT6 signaling pathway
Journal: Int Immunopharmacol | Authors: Mingjia Zhang | Species: mouse | Application: WB - Multi-Omics and Experimental Validation Reveal the Protective Effect of Paeoniflorin Against Coronary Heart Disease in Mice via Inhibiting the C3-Cfd-C3aR Pathway.
Journal: Int J Mol Sci | Authors: Ying Yang - Methyl Gallate Alleviates Acute Ulcerative Colitis by Modulating Gut Microbiota and Inhibiting TLR4/NF-κB Pathway
Journal: Int J Mol Sci | Authors: Ping Zhou | Species: mouse | Application: WB - Anethole trithione mitigates LPS/D-Gal-induced acute liver injury by suppressing ROS production and NF-κB activity
Journal: Int Immunopharmacol | Authors: Zhen He | Species: human | Application: WB - Soluble Epoxide Hydrolase Inhibition Attenuates Proteinuria by Alleviating Renal Inflammation and Podocyte Injuries in Adriamycin-Induced Nephropathy
Journal: Int J Mol Sci | Authors: Qingyu Niu | Species: rat | Application: WB - Structural polysaccharide PCP1 from Polygonatum cyrtonema Hua attenuates atherosclerosis via dual-target suppression of CD36/MSR1 and TLR4/NF-κB pathways.
Journal: Int Immunopharmacol | Authors: Lutan Zhou | Species: mouse | Application: WB, IF - Corynebacterium striatum drives neutrophilic asthma via IL-17 signaling activation
Journal: Int Immunopharmacol | Authors: Xin Yu - The Potential of Siraitia grosvenorii to Promote Bone Regeneration via Modulating Macrophage Polarization: A Network Pharmacology and Experimental Study
Journal: Int J Mol Sci | Authors: Yuying Mai | Species: rat | Application: IHC - Sinomenine contributes to the inhibition of the inflammatory response and the improvement of osteoarthritis in mouse-cartilage cells by acting on the Nrf2/HO-1 and NF-κB signaling pathways.
Journal: Int Immunopharmacol | Authors: Yifan Wu | Species: mouse | Application: WB - GCN2 activates macrophage autophagy to inhibit NLRP3 inflammasome-mediated acute lung injury.
Journal: Int Immunopharmacol | Authors: Yun Xie | Species: mouse | Application: WB - Jatrorrhizine retard obesity by modulating transcription factor c-Jun/c-Fos to downregulate Mmp12-mediated inflammation
Journal: Int Immunopharmacol | Authors: Zhengcai Ma | Species: mouse | Application: WB - Deficiency of inducible nitric oxide synthase alleviates dermal fibrosis and inflammation in scleroderma.
Journal: Int Immunopharmacol | Authors: Jing Luo - Ulinastatin ameliorates preeclampsia induced by N(gamma)-nitro-l-arginine methyl ester in a rat model via inhibition of the systemic and placental inflammatory response
Journal: J Hypertens | Authors: Zhiqiang Yu | Species: rat | Application: WB - Plasma-derived exosomes in chronic spontaneous urticaria induce the release of inflammatory mediators from mast cell through miRNA-619-5p/SOCS4 pathway.
Journal: Int Immunopharmacol | Authors: Runxiang Li - The immunoregulator β-glucan produces antidepressant effects through microglia-mobilized astrocytic P2Y1R-BDNF signaling in the dentate gyrus
Journal: Int Immunopharmacol | Authors: Rongrong Song - Cathepsin B Regulates Mice Granulosa Cells' Apoptosis and Proliferation In Vitro.
Journal: Int J Mol Sci | Authors: Chao Chen | Species: mouse | Application: WB - Structural polysaccharide PCP1 from Polygonatum cyrtonema Hua attenuates atherosclerosis via dual-target suppression of CD36/MSR1 and TLR4/NF-κB pathways.
Journal: Int Immunopharmacol | Authors: Lutan Zhou | Species: mouse | Application: WB, IF - 10-Hydroxydecanoic acid inhibits LPS-induced inflammation by targeting p53 in microglial cells.
Journal: Int Immunopharmacol | Authors: Mengmeng You | Species: rat | Application: WB - MNSFβ promotes LPS-induced TNFα expression by increasing the localization of RC3H1 to stress granules, and the interfering peptide HEPN2 reduces TNFα production by disrupting the MNSFβ-RC3H1 interaction in macrophages
Journal: Int Immunopharmacol | Authors: Han-Yu Jiang | Species: human | Application: WB - FXR-mediated transcriptional regulation of KLF11 mitigates contrast-induced acute kidney injury via suppressing JAK2/STAT3 pathway.
Journal: Int Immunopharmacol | Authors: Bo-Wei Su | Species: mouse,human | Application: WB, IHC, IF - Plasma-derived exosomes in chronic spontaneous urticaria induce the release of inflammatory mediators from mast cell through miRNA-619-5p/SOCS4 pathway.
Journal: Int Immunopharmacol | Authors: Runxiang Li - Andrograpanin attenuates secondary neuroinflammation after spinal cord injury by modulating microglial glycolysis via HIF-1α.
Journal: Int Immunopharmacol | Authors: Bin Dai | Species: mouse | Application: WB,IF - Moscatilin alleviates severe acute pancreatitis by activating the NRF2/HO-1 pathway to inhibit ferroptosis.
Journal: Int Immunopharmacol | Authors: Liangkun Niu | Species: mouse | Application: WB - The role of TGF-β-activated kinase 1 in db/db mice and high glucose-induced macrophage.
Journal: Int Immunopharmacol | Authors: Xingxin Xu | Species: mouse | Application: IHC - GABA-mediated activated microglia induce neuroinflammation in the hippocampus of mice following cold exposure through the NLRP3 inflammasome and NF-κB signaling pathways.
Journal: Int Immunopharmacol | Authors: Limin Lang | Species: mouse | Application: WB - Dendrobine Alleviates Cellular Senescence and Osteoarthritis via the ROS/NF-κB Axis
Journal: Int J Mol Sci | Authors: Haitao Chen | Species: rat | Application: WB - Chronic Intermittent Hypoxia Exacerbates High-Fat Diet-Induced MASLD Through Lipid Metabolic Reprogramming, Impaired Antioxidant Defense, and NF-κB/NLRP3 Activation.
Journal: Biomolecules | Authors: Lisong Ye | Species: mouse | Application: WB - Anti-tumour effects of red blood cell membrane-camouflaged black phosphorous quantum dots combined with chemotherapy and anti-inflammatory therapy.
Journal: Artif Cells Nanomed Biotechnol | Authors: Xueyuan Huang | Species: human | Application: WB,IF - Oleanolic acid inhibits mesangial cell proliferation and inflammatory response in mesangial proliferative glomerulonephritis through IL-17/ERK/AKT pathway
Journal: Int Immunopharmacol | Authors: Dan Pan | Species: rat | Application: WB - Ulinastatin ameliorates preeclampsia induced by N(gamma)-nitro-l-arginine methyl ester in a rat model via inhibition of the systemic and placental inflammatory response
Journal: J Hypertens | Authors: Zhiqiang Yu | Species: rat | Application: WB - The protective effect of Lcn2 activation on salivary gland injury in sialadenitis.
Journal: Int Immunopharmacol | Authors: Guijuan Feng - Click-Chemistry-Based Antibacterial Hybrid Hydrogel with Sustained Puerarin Release for Diabetic Wound Healing.
Journal: ACS Appl Bio Mater | Authors: Shuangyan Jiang - CX3CR1/P2X4R signaling-mediated spinal microglial M1 polarization contributes to chronic pelvic pain in endometriosis.
Journal: Int Immunopharmacol | Authors: Qiong Wu | Species: mouse,human | Application: WB - Hypoxia-Induced Extracellular Vesicles Derived from Human Umbilical Cord Mesenchymal Stem Cells Regulate Macrophage Polarization and Enhance Angiogenesis to Promote Diabetic Wound Healing.
Journal: Biomolecules | Authors: Yongfeng Su | Species: rat | Application: IHC,IF - Corynebacterium striatum drives neutrophilic asthma via IL-17 signaling activation
Journal: Int Immunopharmacol | Authors: Xin Yu - Isoliquiritin ameliorates rheumatoid arthritis by inhibiting S1P synthesis.
Journal: Int Immunopharmacol | Authors: Xin-Ran Hu - Sinomenine contributes to the inhibition of the inflammatory response and the improvement of osteoarthritis in mouse-cartilage cells by acting on the Nrf2/HO-1 and NF-κB signaling pathways.
Journal: Int Immunopharmacol | Authors: Yifan Wu | Species: mouse | Application: WB - Gastrodin against oxidative stress-inflammation crosstalk via inhibiting mtDNA/TLR9 and JAK2/STAT3 signaling to ameliorate ischemic stroke injury
Journal: Int Immunopharmacol | Authors: Menglian Zhang | Application: WB - Copper and arsenic-induced oxidative stress and immune imbalance are associated with activation of heat shock proteins in chicken intestines.
Journal: Int Immunopharmacol | Authors: Yu Wang | Application: WB - CX3CR1/P2X4R signaling-mediated spinal microglial M1 polarization contributes to chronic pelvic pain in endometriosis.
Journal: Int Immunopharmacol | Authors: Qiong Wu | Species: mouse,human | Application: WB - Targeting RXRα inhibits foamy macrophage formation and neuroinflammation by promoting cholesterol efflux channels post traumatic spinal cord injury.
Journal: Int Immunopharmacol | Authors: Rulin Li | Species: mouse | Application: IF - FOXO4-DRI alleviates age-related testosterone secretion insufficiency by targeting senescent Leydig cells in aged mice.
Journal: Aging (Albany NY) | Authors: Chi Zhang | Species: mouse | Application: WB - BDNF-VGF Pathway Aggravates Incision Induced Acute Postoperative Pain via Upregulating the Neuroinflammation in Dorsal Root Ganglia
Journal: Mol Neurobiol | Authors: Wenjing Zhao | Species: rat | Application: WB,IF - MANF Alleviates Sevoflurane-Induced Cognitive Impairment in Neonatal Mice by Modulating Microglial Activation and Polarization
Journal: Mol Neurobiol | Authors: Jie Gao | Species: mouse | Application: WB - A Novel Rat Model of Dry Eye Induced by Aerosol Exposure of Particulate Matter.
Journal: Invest Ophthalmol Vis Sci | Authors: Ning Mu | Species: rat | Application: WB - The Role of Autophagy in the Innate Immune Response to Fungal Keratitis Caused by Aspergillus fumigatus Infection.
Journal: Invest Ophthalmol Vis Sci | Authors: Chenyu Li | Species: mouse | Application: WB - VISTA Deficiency Exacerbates Autoimmune Uveitis by Promoting Microglial Activation via the TLR4/MyD88/NF-κB Pathway.
Journal: Invest Ophthalmol Vis Sci | Authors: Hui Feng - Neferine alleviated corticosterone-induced depressive-like behaviors in mice via the inhibition of TNF/NF-κB pathway by binding to PPARγ.
Journal: Mol Neurobiol | Authors: Chen-di Zhao | Species: mouse | Application: WB,IF - PD-1 Attenuates Neuropathic Pain by Ameliorating NLRP3 Inflammasome-Mediated Microglia Pyroptosis
Journal: Mol Neurobiol | Authors: Daling Deng | Species: mouse | Application: WB - PPARα-Dependent Effects of Palmitoylethanolamide Against Retinal Neovascularization and Fibrosis.
Journal: Invest Ophthalmol Vis Sci | Authors: Sihao Ye | Species: rat,mouse | Application: WB - Silencing of Ifi27l2a Attenuates Inflammation After Spinal Cord Injury by Regulating Microglial Polarization via JAK2/STAT3 Signaling.
Journal: Mol Neurobiol | Authors: Wenhao Chen | Species: mouse | Application: WB - AICAR improves depression-like behaviors and is associated with hippocampal AMPK activation and modulation of neurogenesis and neuroinflammation in a microbiota disruption model.
Journal: Neurochem Int | Authors: Kohei Takahashi | Species: mouse | Application: WB - A Novel Effect of Id2 in Microglia TNFα Regulation
Journal: Mol Neurobiol | Authors: Wenhui Wang | Species: mouse | Application: WB - Allocryptopine Attenuates Inflammatory Responses in Microglial Cells Via TLR4-Dependent NF-κB and p38 MAPK Pathways
Journal: Mol Neurobiol | Authors: Serap Nigdelioglu Dolanbay | Species: mouse | Application: WB - Red nucleus mGluR2 but not mGluR3 mediates inhibitory effect in the development of SNI-induced neuropathological pain by suppressing the expressions of TNF-α and IL-1β
Journal: Neurochem Int | Authors: Wen-Tao Wang | Species: rat | Application: WB,IHC - MANF Alleviates Sevoflurane-Induced Cognitive Impairment in Neonatal Mice by Modulating Microglial Activation and Polarization
Journal: Mol Neurobiol | Authors: Jie Gao | Species: mouse | Application: WB - Silencing of Ifi27l2a Attenuates Inflammation After Spinal Cord Injury by Regulating Microglial Polarization via JAK2/STAT3 Signaling.
Journal: Mol Neurobiol | Authors: Wenhao Chen | Species: mouse | Application: WB - Neuroprotection of cannabidiol in epileptic rats: Gut microbiome and metabolome sequencing
Journal: Front Nutr | Authors: Xiaoxiang Gong | Species: rat | Application: WB - RNF213 Knockdown and Inflammation Promote Angiogenesis and Phenotype Switching by JAK2/STAT3 Pathway in Moyamoya Disease
Journal: Mol Neurobiol | Authors: Juan Shen | Application: WB - Myelination Trajectory and Microglial Dynamics Following Repeated Sevoflurane Exposure in Developing Brain
Journal: Glia | Authors: Ji Che | Species: mouse | Application: WB - VISTA Deficiency Exacerbates Autoimmune Uveitis by Promoting Microglial Activation via the TLR4/MyD88/NF-κB Pathway.
Journal: Invest Ophthalmol Vis Sci | Authors: Hui Feng - The Role of Autophagy in the Innate Immune Response to Fungal Keratitis Caused by Aspergillus fumigatus Infection.
Journal: Invest Ophthalmol Vis Sci | Authors: Chenyu Li | Species: mouse | Application: WB - MANF Alleviates Sevoflurane-Induced Cognitive Impairment in Neonatal Mice by Modulating Microglial Activation and Polarization
Journal: Mol Neurobiol | Authors: Jie Gao | Species: mouse | Application: WB - A Novel Effect of Id2 in Microglia TNFα Regulation
Journal: Mol Neurobiol | Authors: Wenhui Wang | Species: mouse | Application: WB - RNF213 Knockdown and Inflammation Promote Angiogenesis and Phenotype Switching by JAK2/STAT3 Pathway in Moyamoya Disease
Journal: Mol Neurobiol | Authors: Juan Shen | Application: WB - New insights of necroptosis and immune infiltration in sepsis-induced myocardial dysfunction from bioinformatics analysis through RNA-seq in mice
Journal: Front Cell Infect Microbiol | Authors: Yan Du | Species: mouse | Application: WB - An Integrative Pharmacology Model for Decoding the Underlying Therapeutic Mechanisms of Ermiao Powder for Rheumatoid Arthritis.
Journal: Front Pharmacol | Authors: Jie Wu | Species: mouse | Application: WB - Therapeutic effects of shaogan fuzi decoction in rheumatoid arthritis: Network pharmacology and experimental validation
Journal: Front Pharmacol | Authors: Lu Shi | Species: rat | Application: WB - Balanophora polysaccharide improves renal injury and fibrosis in db/db diabetic nephropathy mice via NLRP3 inflammasome mediated inflammation.
Journal: Front Pharmacol | Authors: Chaoxi Tian | Species: mouse | Application: WB - Exploring the molecular mechanism of notoginsenoside R1 in sepsis-induced cardiomyopathy based on network pharmacology and experiments validation
Journal: Front Pharmacol | Authors: Ruifei Shao | Species: human | Application: IF - CS-semi5 Inhibits NF-κB Activation to Block Synovial Inflammation, Cartilage Loss and Bone Erosion Associated With Collagen-Induced Arthritis.
Journal: Front Pharmacol | Authors: Xiang Li | Species: mouse | Application: WB - Dapagliflozin promotes angiogenesis in hindlimb ischemia mice by inducing M2 macrophage polarization
Journal: Front Pharmacol | Authors: Heng Yang | Species: mouse | Application: WB - RUNX1 Induces Central Neuropathic Pain by Activating Microglia and Triggering the Inflammatory Response in Spinal Cord Injury
Journal: Inflammation | Authors: Mengjie Huang | Species: mouse | Application: WB - Indole-3-Carbinol Selectively Prevents Chronic Stress-Induced Depression-but not Anxiety-Like Behaviors via Suppressing Pro-Inflammatory Cytokine Production and Oxido-Nitrosative Stress in the Brain.
Journal: Front Pharmacol | Authors: Shengying Pan | Species: mouse - CoenzymeQ10-Induced Activation of AMPK-YAP-OPA1 Pathway Alleviates Atherosclerosis by Improving Mitochondrial Function, Inhibiting Oxidative Stress and Promoting Energy Metabolism.
Journal: Front Pharmacol | Authors: Tianqi Xie | Species: mouse | Application: WB - CoenzymeQ10-Induced Activation of AMPK-YAP-OPA1 Pathway Alleviates Atherosclerosis by Improving Mitochondrial Function, Inhibiting Oxidative Stress and Promoting Energy Metabolism.
Journal: Front Pharmacol | Authors: Tianqi Xie | Species: mouse | Application: WB - Novel recombinant protein flagellin A N/C attenuates experimental autoimmune encephalomyelitis by suppressing the ROS/NF-κB/NLRP3 signaling pathway
Journal: Front Pharmacol | Authors: Li Li | Species: mouse | Application: WB - Integrated proteomics analysis and network pharmacology to elucidate the mechanism of Zhilong Huoxue Tongyu Capsule alleviate hypertensive retinopathy in Ang II infusion mice model
Journal: Front Pharmacol | Authors: Jiao Wu - Therapeutic effects of shaogan fuzi decoction in rheumatoid arthritis: Network pharmacology and experimental validation
Journal: Front Pharmacol | Authors: Lu Shi | Species: rat | Application: WB - RUNX1 Induces Central Neuropathic Pain by Activating Microglia and Triggering the Inflammatory Response in Spinal Cord Injury
Journal: Inflammation | Authors: Mengjie Huang | Species: mouse | Application: WB - Indole-3-Carbinol Selectively Prevents Chronic Stress-Induced Depression-but not Anxiety-Like Behaviors via Suppressing Pro-Inflammatory Cytokine Production and Oxido-Nitrosative Stress in the Brain.
Journal: Front Pharmacol | Authors: Shengying Pan | Species: mouse - Integrated proteomics analysis and network pharmacology to elucidate the mechanism of Zhilong Huoxue Tongyu Capsule alleviate hypertensive retinopathy in Ang II infusion mice model
Journal: Front Pharmacol | Authors: Jiao Wu - Ibudilast Attenuates Folic Acid-Induced Acute Kidney Injury by Blocking Pyroptosis Through TLR4-Mediated NF-κB and MAPK Signaling Pathways.
Journal: Front Pharmacol | Authors: Xue Li | Species: mouse | Application: WB - Protective Effects of Costunolide Against D-Galactosamine and Lipopolysaccharide-Induced Acute Liver Injury in Mice.
Journal: Front Pharmacol | Authors: Jingxin Mao | Species: mouse | Application: WB - Distinct neuroprotective and anti-inflammatory effects of Kampo formulas ninjinyoeito and juzentaihoto in depression-like SAMP8 mice.
Journal: Front Pharmacol | Authors: Akiko Maruko | Species: mouse | Application: WB - Irisin Alleviates Autoimmune Uveitis Through Promoting Retinal Microglial M1 to M2 Phenotypic Polarization Mediated by HIF-1α Pathway
Journal: Inflammation | Authors: Meiqi Wang | Species: human | Application: WB - Balanophora polysaccharide improves renal injury and fibrosis in db/db diabetic nephropathy mice via NLRP3 inflammasome mediated inflammation.
Journal: Front Pharmacol | Authors: Chaoxi Tian | Species: mouse | Application: WB - An Integrative Pharmacology Model for Decoding the Underlying Therapeutic Mechanisms of Ermiao Powder for Rheumatoid Arthritis.
Journal: Front Pharmacol | Authors: Jie Wu | Species: mouse | Application: WB - Irisin Alleviates Autoimmune Uveitis Through Promoting Retinal Microglial M1 to M2 Phenotypic Polarization Mediated by HIF-1α Pathway
Journal: Inflammation | Authors: Meiqi Wang | Species: human | Application: WB - 4-octyl Itaconate Attenuates Acute Pancreatitis and Associated Lung Injury by Suppressing Ferroptosis in Mice
Journal: Inflammation | Authors: Shimin Lu | Species: mouse | Application: WB - Dapagliflozin promotes angiogenesis in hindlimb ischemia mice by inducing M2 macrophage polarization
Journal: Front Pharmacol | Authors: Heng Yang | Species: mouse | Application: WB - RUNX1 Induces Central Neuropathic Pain by Activating Microglia and Triggering the Inflammatory Response in Spinal Cord Injury
Journal: Inflammation | Authors: Mengjie Huang | Species: mouse | Application: WB - Emodin mitigates rheumatoid arthritis through direct binding to TNF-α
Journal: Front Pharmacol | Authors: Dingyan Lu | Species: human | Application: WB - Neuroprotective mechanisms of valproic acid and alpha-lipoic acid in ALS: a network pharmacology-based investigation.
Journal: Front Pharmacol | Authors: Dongmei Zhang | Species: mouse | Application: WB - Protective Effects of Costunolide Against D-Galactosamine and Lipopolysaccharide-Induced Acute Liver Injury in Mice.
Journal: Front Pharmacol | Authors: Jingxin Mao | Species: mouse | Application: WB - Berberine alleviates atherosclerosis by modulating autophagy and inflammation through the RAGE-NF-κB pathway
Journal: Front Pharmacol | Authors: Peng Zhang | Species: mouse | Application: IF - Thrombopoietin Mitigates Neuronal Death by Enhancing Mitophagy and Suppressing NLRP3 Inflammasome Activation Under Oxygen-Glucose Deprivation Conditions
Journal: Am J Physiol Cell Physiol | Authors: Liang Li | Application: WB - Druggable Mendelian randomization prioritizes CDH2 and supports finerenone as a candidate therapeutic strategy for diabetic retinopathy.
Journal: Front Pharmacol | Authors: Xiangyang Liu - Protection of CAPE-pNO2 Against Chronic Myocardial Ischemia by the TGF-Β1/Galectin-3 Pathway In Vivo and In Vitro.
Journal: Inflammation | Authors: Qin Wan | Species: rat | Application: WB,IF - Targeting carbonic anhydrase IX-mediated ferroptosis by atractylenolide I alleviates DSS-induced colitis in mice.
Journal: Front Pharmacol | Authors: Yan Wang - Neuroprotective mechanisms of valproic acid and alpha-lipoic acid in ALS: a network pharmacology-based investigation.
Journal: Front Pharmacol | Authors: Dongmei Zhang | Species: mouse | Application: WB - Silencing lncRNA TUG1 Alleviates LPS-Induced Mouse Hepatocyte Inflammation by Targeting miR-140/TNF.
Journal: Front Cell Dev Biol | Authors: Qing-Min Liu | Species: mouse | Application: WB - RNA-Binding Protein HuR Suppresses Inflammation and Promotes Extracellular Matrix Homeostasis via NKRF in Intervertebral Disc Degeneration.
Journal: Front Cell Dev Biol | Authors: Zhenxuan Shao | Species: rat | Application: WB - Exploring the therapeutic mechanism of curcumin in spinal cord injury treatment based on network pharmacology, molecular dynamics simulation, and experimental validation
Journal: Front Chem | Authors: Yongzhi He | Species: rat | Application: WB - Hydroxyurea mitigates diabetic kidney disease through mTOR-S6K signaling pathway in STZ-induced diabetic mice
Journal: Front Cell Dev Biol | Authors: Wanying Cheng | Species: human | Application: WB - Porcine cells restrict human cell proliferation via cellular competition in a human-porcine mesenchymal stem cells co-culture model.
Journal: Front Cell Dev Biol | Authors: Xinyuan Fan | Species: human | Application: WB - Hydroxyurea mitigates diabetic kidney disease through mTOR-S6K signaling pathway in STZ-induced diabetic mice
Journal: Front Cell Dev Biol | Authors: Wanying Cheng | Species: human | Application: WB - RNA-Binding Protein HuR Suppresses Inflammation and Promotes Extracellular Matrix Homeostasis via NKRF in Intervertebral Disc Degeneration.
Journal: Front Cell Dev Biol | Authors: Zhenxuan Shao | Species: rat | Application: WB - miR-7-5p Affects Brain Edema After Intracerebral Hemorrhage and Its Possible Mechanism.
Journal: Front Cell Dev Biol | Authors: Xiqian Chen | Species: rat | Application: WB - Polystyrene nanoplastics induce hippocampal damage and cognitive deficits through oxidative stress-triggered microglial extracellular traps and neuronal ferroptosis.
Journal: Chem Biol Interact | Authors: Jia Hu | Species: mouse | Application: WB - Ultrasmall Prussian blue nanoparticles attenuate UVA-induced cellular senescence in human dermal fibroblasts via inhibiting the ERK/AP-1 pathway
Journal: Nanoscale | Authors: Yueyue Li | Species: human | Application: WB - Forsythiaside A attenuates lipopolysaccharide-induced mouse mastitis by activating autophagy and regulating gut microbiota and metabolism
Journal: Chem Biol Interact | Authors: Yingkui Gao | Species: mouse | Application: WB - Fabrication of an Adhesive Small Intestinal Submucosa Acellular Matrix Hydrogel for Accelerating Diabetic Wound Healing
Journal: ACS Omega | Authors: Yao Chen | Species: mouse | Application: IHC - Sidt2 Knockdown Aggravates Apical Periodontitis Via Autocrine Tumour Necrosis Factor-Alpha.
Journal: Int Dent J | Authors: Biao Li - Determination of the Anti-Oxidative Stress Mechanism of Isodon suzhouensis Leaves by Employing Bioinformatic and Novel Research Technology
Journal: ACS Omega | Authors: Wei Wang | Species: mouse | Application: WB - Role of NF-κB in lead exposure-induced activation of astrocytes based on bioinformatics analysis of hippocampal proteomics
Journal: Chem Biol Interact | Authors: Shi Fan | Species: mouse | Application: WB - Environmental Microcystin exposure in underlying NAFLD-induced exacerbation of neuroinflammation, blood-brain barrier dysfunction, and neurodegeneration are NLRP3 and S100B dependent.
Journal: Toxicology | Authors: Ayan Mondal | Species: mouse | Application: IHC - Sidt2 Knockdown Aggravates Apical Periodontitis Via Autocrine Tumour Necrosis Factor-Alpha.
Journal: Int Dent J | Authors: Biao Li - Dl-3-n-Butylphthalide Promotes Remyelination and Suppresses Inflammation by Regulating AMPK/SIRT1 and STAT3/NF-κB Signaling in Chronic Cerebral Hypoperfusion.
Journal: Front Aging Neurosci | Authors: Meixi Li | Species: rat | Application: WB - Determination of the Anti-Oxidative Stress Mechanism of Isodon suzhouensis Leaves by Employing Bioinformatic and Novel Research Technology
Journal: ACS Omega | Authors: Wei Wang | Species: mouse | Application: WB - Manganese Exposure Aggravates β-Amyloid Pathology by Microglial Activation.
Journal: Front Aging Neurosci | Authors: Geng Lin | Species: mouse | Application: WB - Acrylonitrile exposure triggers ovarian inflammation and decreases oocyte quality probably via mitochondrial dysfunction induced apoptosis in mice.
Journal: Chem Biol Interact | Authors: Yu-Shen Luo | Species: mouse | Application: WB,IHC - Role of NF-κB in lead exposure-induced activation of astrocytes based on bioinformatics analysis of hippocampal proteomics
Journal: Chem Biol Interact | Authors: Shi Fan | Species: mouse | Application: WB - Role of NF-κB in lead exposure-induced activation of astrocytes based on bioinformatics analysis of hippocampal proteomics
Journal: Chem Biol Interact | Authors: Shi Fan | Species: mouse | Application: WB - Acrylonitrile exposure triggers ovarian inflammation and decreases oocyte quality probably via mitochondrial dysfunction induced apoptosis in mice.
Journal: Chem Biol Interact | Authors: Yu-Shen Luo | Species: mouse | Application: WB,IHC - Theaflavin-3,3´-Digallate Prevents Alcoholic Liver Injury by Suppressing Hepatic TLR4/NF-κB Signaling and Modulating the Gut-Liver Axis in Mice
Journal: J Nutr Biochem | Authors: Meng-Ge Tang - Sidt2 Knockdown Aggravates Apical Periodontitis Via Autocrine Tumour Necrosis Factor-Alpha.
Journal: Int Dent J | Authors: Biao Li - Neohesperidin protects against colitis-associated colorectal cancer in mice via suppression of the NF-κB/p65 and MAPK pathways
Journal: J Nutr Biochem | Authors: Xingyue Cao | Species: mouse | Application: WB - Perfluorooctane Sulfonate Induces Autophagy-Dependent Apoptosis through Spinster 1-Mediated lysosomal-Mitochondrial Axis and Impaired Mitophagy.
Journal: Toxicol Sci | Authors: Xiaofeng Yao - Diosmetin exerts anti-oxidative, anti-inflammatory and anti-apoptotic effects to protect against endotoxin-induced acute hepatic failure in mice.
Journal: Oncotarget | Authors: You Yang | Species: mouse | Application: WB - Hepatoprotective effects of zinc (II) via cytochrome P-450/reactive oxygen species and canonical apoptosis pathways after arsenite waterborne exposure in common carp.
Journal: Chemosphere | Authors: Hongjing Zhao | Species: fish | Application: WB - Macelignan targets SLC7A11 to induce ferroptosis and modulate macrophage polarization via STAT6/PPAR-γ/KLF4 signaling.
Journal: Bioorg Chem | Authors: Dianyu Sun | Species: mouse | Application: WB - The Anticonvulsant Effects of Baldrinal on Pilocarpine-Induced convulsion in Adult Male Mice.
Journal: Molecules | Authors: Xiao Zhang | Species: mouse | Application: WB - Co-Mn Complex Oxide Nanoparticles as Potential Reactive Oxygen Species Scavenging Agents for Pulmonary Fibrosis Treatment
Journal: Molecules | Authors: Wuhao Yang | Species: mouse | Application: IHC - X-Paste improves wound healing in diabetes via NF-E2-related factor/HO-1 signaling pathway
Journal: World J Diabetes | Authors: Ming-Wei Du | Species: mouse | Application: WB - Synthesis and anti-inflammatory activity of paeonol derivatives with etherized aryl urea by regulating TLR4/MyD88 signaling pathway in RAW264.7 cell.
Journal: Bioorg Chem | Authors: Xiaobao Gong | Species: mouse | Application: WB - Diacylated anthocyanins from purple sweet potato (Ipomoeabatatas L.) attenuate hyperglycemia and hyperuricemia in mice induced by a high-fructose/high-fat diet
Journal: J Zhejiang Univ Sci B | Authors: Luhong Shen - Discovery of novel dihydropyrazole-stilbene derivatives for ameliorating heart failure through modulation of p38/NF-κB signaling pathway
Journal: Bioorg Chem | Authors: Zhigang Liu | Species: mouse | Application: WB - Effects of the total saponins from Rosa laevigata Michx fruit against acetaminophen-induced liver damage in mice via induction of autophagy and suppression of inflammation and apoptosis.
Journal: Molecules | Authors: Deshi Dong | Species: mouse | Application: WB - Nephroprotective mechanism of Kunkui Baoshen decoction in diabetic kidney disease: Targeting the HERC2/NCOA4-mediated autophagy-dependent ferroptosis pathway.
Journal: World J Diabetes | Authors: Si-Yuan Song | Species: mouse,human | Application: WB,IHC,IF - Co-Mn Complex Oxide Nanoparticles as Potential Reactive Oxygen Species Scavenging Agents for Pulmonary Fibrosis Treatment
Journal: Molecules | Authors: Wuhao Yang | Species: mouse | Application: IHC - Design, synthesis, and biological evaluation of pyranone-carbamate hybrids as selective butyrylcholinesterase inhibitors with anti-neuroinflammatory activity for Alzheimer's disease.
Journal: Bioorg Chem | Authors: Xueyan Liu | Species: mouse | Application: IF - Effects of the total saponins from Rosa laevigata Michx fruit against acetaminophen-induced liver damage in mice via induction of autophagy and suppression of inflammation and apoptosis.
Journal: Molecules | Authors: Deshi Dong | Species: mouse | Application: WB - Polydatin, a derivative of resveratrol, ameliorates busulfan-induced oligozoospermia in mice by inhibiting NF-κB pathway activation and suppressing ferroptosis
Journal: Bioorg Chem | Authors: Chengniu Wang | Species: mouse | Application: WB,IF - Diacylated anthocyanins from purple sweet potato (Ipomoeabatatas L.) attenuate hyperglycemia and hyperuricemia in mice induced by a high-fructose/high-fat diet
Journal: J Zhejiang Univ Sci B | Authors: Luhong Shen - Macelignan targets SLC7A11 to induce ferroptosis and modulate macrophage polarization via STAT6/PPAR-γ/KLF4 signaling.
Journal: Bioorg Chem | Authors: Dianyu Sun | Species: mouse | Application: WB - Discovery of novel dihydropyrazole-stilbene derivatives for ameliorating heart failure through modulation of p38/NF-κB signaling pathway
Journal: Bioorg Chem | Authors: Zhigang Liu | Species: mouse | Application: WB - Anti-Inflammatory Activity of 4-(4-(Heptyloxy)phenyl)-2,4-dihydro-3H-1,2,4-triazol-3-one via Repression of MAPK/NF-κB Signaling Pathways in β-Amyloid-Induced Alzheimer's Disease Models
Journal: Molecules | Authors: Fengmao An | Species: human | Application: WB - Inhibition of calcineurin/NFATc4 signaling attenuates ventilator‑induced lung injury.
Journal: Mol Med Rep | Authors: Min Li | Species: rat | Application: WB - Prediction and identification of B‑cell epitopes for tumor necrosis factor‑α.
Journal: Mol Med Rep | Authors: Jun Zhang - Dauricine Inhibits Macrophages M2 Polarization and Regulates the Progression and Ferroptosis via HCK/IDO1 in Urinary Bladder Cancer.
Journal: Food Sci Nutr | Authors: Jie Gong | Species: mouse,human | Application: WB,IHC,IF - SOST gene suppression stimulates osteocyte Wnt/β-catenin signaling to prevent bone resorption and attenuates particle-induced osteolysis
Journal: J Mol Med (Berl) | Authors: Zixue Jiao | Species: mouse | Application: WB - A neutral polysaccharide from Ophiocordyceps lanpingensis restrains cisplatin-induced nephrotoxicity.
Journal: Food Sci Nutr | Authors: Shubo Zhou | Species: mouse | Application: WB - Dauricine Inhibits Macrophages M2 Polarization and Regulates the Progression and Ferroptosis via HCK/IDO1 in Urinary Bladder Cancer.
Journal: Food Sci Nutr | Authors: Jie Gong | Species: mouse,human | Application: WB,IHC,IF - A neutral polysaccharide from Ophiocordyceps lanpingensis restrains cisplatin-induced nephrotoxicity.
Journal: Food Sci Nutr | Authors: Shubo Zhou | Species: mouse | Application: WB - H3K27ac-induced IFITM3 promotes progression of TNBC and resistance to anti-PD-1/PD-L1 therapy via the TNF-α/NF-κB/PD-L1 axis.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Guangyan Li | Species: human | Application: WB, IHC, IF - SOST gene suppression stimulates osteocyte Wnt/β-catenin signaling to prevent bone resorption and attenuates particle-induced osteolysis
Journal: J Mol Med (Berl) | Authors: Zixue Jiao | Species: mouse | Application: WB - Hydrogen sulfide attenuates TMAO‑induced macrophage inflammation through increased SIRT1 sulfhydration
Journal: Mol Med Rep | Authors: Mi-Hua Liu | Species: mouse | Application: WB - p38 mitogen-activated protein kinase inhibition modulates nucleus pulposus cell apoptosis in spontaneous resorption of herniated intervertebral discs: An experimental study in rats.
Journal: Mol Med Rep | Authors: Yu Zhu - Acute carbon monoxide poisoning induces renal inflammation and apoptosis via CCL4 upregulation and activation of the PI3K/Akt pathway in mice.
Journal: Mol Med Rep | Authors: Yu Ni | Species: mouse | Application: WB - Brevilin A reverses colitis of inflammatory bowel disease via modulation of TNF-α signaling and microbiome dysregulation.
Journal: Gut Pathog | Authors: Liming Chen | Species: mouse | Application: WB,IF - H3K27ac-induced IFITM3 promotes progression of TNBC and resistance to anti-PD-1/PD-L1 therapy via the TNF-α/NF-κB/PD-L1 axis.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Guangyan Li | Species: human | Application: WB, IHC, IF - Inhibition of calcineurin/NFATc4 signaling attenuates ventilator‑induced lung injury.
Journal: Mol Med Rep | Authors: Min Li | Species: rat | Application: WB - Microglial GLUL loss worsens TBI outcomes by amplifying the arginine-citrulline pathway.
Journal: Biochim Biophys Acta Mol Basis Dis | Authors: Jianwei Li | Species: mouse | Application: WB - Vagus Nerve Stimulation Attenuates Acute Skeletal Muscle Injury Induced by Ischemia-Reperfusion in Rats.
Journal: Oxid Med Cell Longev | Authors: Yifeng Zhang | Species: rat | Application: WB - 1-Trichloromethyl-1,2,3,4-tetrahydro-beta-carboline (TaClo) Induces the Apoptosis of Dopaminergic Neurons via Oxidative Stress and Neuroinflammation.
Journal: Oxid Med Cell Longev | Authors: Yihang Yang | Species: rat | Application: WB - Protein Kinase A Is Involved in Neuropathic Pain by Activating the p38MAPK Pathway to Mediate Spinal Cord Cell Apoptosis.
Journal: Mediators Inflamm | Authors: Yajun Deng | Species: rat | Application: WB - Mechanisms of Microglial NLRP3 Inflammasome Activation by Methylmalonic Acid in Methylmalonic Acidemia.
Journal: Mediators Inflamm | Authors: Shuqi Sun | Species: mouse | Application: WB - Curcumin enhances elvitegravir concentration and alleviates oxidative stress and inflammatory response
Journal: Sci Rep | Authors: Sandip Godse | Species: human | Application: WB - Blockage of transient receptor potential vanilloid 4 prevents postoperative atrial fibrillation by inhibiting NLRP3-inflammasome in sterile pericarditis mice.
Journal: Cell Calcium | Authors: Shuaitao Yang | Species: mouse | Application: WB - The Effects of Sidt2 on the Inflammatory Pathway in Mouse Mesangial Cells.
Journal: Mediators Inflamm | Authors: Hui Sun | Species: mouse | Application: WB - MicroRNA-499 Rs3746444 polymorphism and biliary atresia.
Journal: Dig Liver Dis | Authors: Yuhua Shan | Species: human | Application: IHC - The Effects of Sidt2 on the Inflammatory Pathway in Mouse Mesangial Cells.
Journal: Mediators Inflamm | Authors: Hui Sun | Species: mouse | Application: WB - Galactin-8 DNA methylation mediates macrophage autophagy through the MAPK/mTOR pathway to alleviate atherosclerosis
Journal: Sci Rep | Authors: Bing Xia | Species: mouse | Application: WB - Mechanisms of Microglial NLRP3 Inflammasome Activation by Methylmalonic Acid in Methylmalonic Acidemia.
Journal: Mediators Inflamm | Authors: Shuqi Sun | Species: mouse | Application: WB - Blockage of transient receptor potential vanilloid 4 prevents postoperative atrial fibrillation by inhibiting NLRP3-inflammasome in sterile pericarditis mice.
Journal: Cell Calcium | Authors: Shuaitao Yang | Species: mouse | Application: WB - Alleviation of Hepatic Ischemia Reperfusion Injury by Oleanolic Acid Pretreating via Reducing HMGB1 Release and Inhibiting Apoptosis and Autophagy.
Journal: Mediators Inflamm | Authors: Wenwen Wang | Species: mouse | Application: WB,IHC - The Effects of Sidt2 on the Inflammatory Pathway in Mouse Mesangial Cells.
Journal: Mediators Inflamm | Authors: Hui Sun | Species: mouse | Application: WB - The Protective Effects of Levo-Tetrahydropalmatine on ConA-Induced Liver Injury Are via TRAF6/JNK Signaling.
Journal: Mediators Inflamm | Authors: Qiang Yu | Species: mouse | Application: WB,IHC - Grape Seed Proanthocyanidins Exert a Neuroprotective Effect by Regulating Microglial M1/M2 Polarisation in Rats with Spinal Cord Injury
Journal: Mediators Inflamm | Authors: Wen-zhao Liu | Species: rat,mouse | Application: WB - BTK promotes neuroinflammation after intracerebral hemorrhage involving hub genes and alterations in microglial functions.
Journal: Sci Rep | Authors: Siqi Xia | Species: mouse | Application: WB - Exploring the effect and mechanism of baicalin on sepsis-induced acute lung injury based on network pharmacology and experimental verification.
Journal: Sci Rep | Authors: Pengwei Wang | Species: mouse | Application: WB - Identification of subclusters and prognostic genes based on GLS-associated molecular signature in ulcerative colitis
Journal: Sci Rep | Authors: Yang Xie | Species: human | Application: WB - A designer polyQ fusion protein modulates NF-κB signaling by sequestering P65/RelA into aggregates
Journal: Sci Rep | Authors: Xiang-Le Zhang | Species: human | Application: WB - MicroRNA-499 Rs3746444 polymorphism and biliary atresia.
Journal: Dig Liver Dis | Authors: Yuhua Shan | Species: human | Application: IHC - Exploring the effect and mechanism of baicalin on sepsis-induced acute lung injury based on network pharmacology and experimental verification.
Journal: Sci Rep | Authors: Pengwei Wang | Species: mouse | Application: WB - Knee loading inhibits osteoclast lineage in a mouse model of osteoarthritis.
Journal: Sci Rep | Authors: Xinle Li | Species: mouse | Application: WB - The Protective Effects of Levo-Tetrahydropalmatine on ConA-Induced Liver Injury Are via TRAF6/JNK Signaling.
Journal: Mediators Inflamm | Authors: Qiang Yu | Species: mouse | Application: WB,IHC - Resolvin D1 accelerates resolution of neuroinflammation by inhibiting microglia activation through the BDNF/TrkB signaling pathway
Journal: Eur J Med Res | Authors: Cunju Bo | Species: mouse | Application: IF - Uterine immunoprivileged cells restore cardiac function of male recipients after myocardial infarction
Journal: Stem Cells | Authors: Zexu Peng | Species: mouse | Application: WB - Sema3G activates YAP and promotes VSMCs proliferation and migration via Nrp2/PlexinA1
Journal: Cell Signal | Authors: Xue-Yang Luo | Species: mouse,human | Application: WB - CCR5 antagonist maraviroc alleviates doxorubicin-induced neuroinflammation and neurobehavioral deficiency by regulating NF-κB/NLRP3 signaling in a breast cancer mouse model
Journal: Neuropharmacology | Authors: Yuanyuan Wu | Application: WB - Lactiplantibacillus plantarum Y40 Ameliorates Salmonella Infection via PPARγ-Mediated Regulation of Fatty Acid Metabolism in Mice.
Journal: Microorganisms | Authors: Lifang Gu | Species: mouse | Application: WB - Ursolic acid molecules dock MAPK1 to modulate gut microbiota diversity to reduce neuropathic pain
Journal: Neuropharmacology | Authors: Zi-Jie Rong | Species: rat | Application: WB - Study on the effect and mechanism of sesamin on P2X3-related cheek allergic contact dermatitis in mice induced by SADBE stimulation.
Journal: Neuropharmacology | Authors: Xiaoqian Ma | Species: mouse | Application: WB - Spinal astrocyte-derived M-CSF mediates microglial reaction and drives visceral hypersensitivity following DSS-induced colitis
Journal: Neuropharmacology | Authors: Ke Wu | Species: mouse | Application: WB - NQO1 alleviates renal fibrosis by inhibiting the TLR4/NF-κB and TGF-β/Smad signaling pathways in diabetic nephropathy
Journal: Cell Signal | Authors: Duojun Qiu | Species: mouse,human | Application: WB,IHC - Luteolin attenuates Talaromyces marneffei-induced bone destruction by alleviating NLRP3-mediated osteoblast pyroptosis via TNF-α/NF-κB pathway inhibition.
Journal: Cell Signal | Authors: Fayun Yang - Lactiplantibacillus plantarum Y40 Ameliorates Salmonella Infection via PPARγ-Mediated Regulation of Fatty Acid Metabolism in Mice.
Journal: Microorganisms | Authors: Lifang Gu | Species: mouse | Application: WB - Rap1GAP exacerbates myocardial infarction by regulating the AMPK/SIRT1/NF-κB signaling pathway
Journal: Cell Signal | Authors: Tiantian Shan | Species: rat | Application: WB,IHC - Taraxacum officinale extract ameliorates dextran sodium sulphate-induced colitis by regulating fatty acid degradation and microbial dysbiosis.
Journal: J Cell Mol Med | Authors: Wei Chen | Species: mouse | Application: IHC - p38γ modulates ferroptosis in brain injury caused by ethanol and cerebral ischemia/reperfusion by regulating the p53/SLC7A11 signaling pathway
Journal: Cell Signal | Authors: Xingyu Zhu | Species: mouse,human | Application: WB - Lactiplantibacillus plantarum Y40 Ameliorates Salmonella Infection via PPARγ-Mediated Regulation of Fatty Acid Metabolism in Mice.
Journal: Microorganisms | Authors: Lifang Gu | Species: mouse | Application: WB - p16INK4a Deletion Alleviated Obesity-Associated Kidney Fibrosis by Regulating Metabolic Reprogramming and the Inflammasome Pathway
Journal: J Cell Mol Med | Authors: Qian Liu | Species: mouse | Application: WB,IHC - CCR5 antagonist maraviroc alleviates doxorubicin-induced neuroinflammation and neurobehavioral deficiency by regulating NF-κB/NLRP3 signaling in a breast cancer mouse model
Journal: Neuropharmacology | Authors: Yuanyuan Wu | Application: WB - B4GALT1 drives osteoarthritis progression by stabilizing IL-1R1 through N-linked glycosylation.
Journal: Cell Signal | Authors: Weibang Ma | Species: mouse,human | Application: WB - Ursolic acid molecules dock MAPK1 to modulate gut microbiota diversity to reduce neuropathic pain
Journal: Neuropharmacology | Authors: Zi-Jie Rong | Species: rat | Application: WB - Luteolin attenuates Talaromyces marneffei-induced bone destruction by alleviating NLRP3-mediated osteoblast pyroptosis via TNF-α/NF-κB pathway inhibition.
Journal: Cell Signal | Authors: Fayun Yang - NQO1 alleviates renal fibrosis by inhibiting the TLR4/NF-κB and TGF-β/Smad signaling pathways in diabetic nephropathy
Journal: Cell Signal | Authors: Duojun Qiu | Species: mouse,human | Application: WB,IHC - The adenosine A(2A) receptor antagonist KW6002 mitigates aldosterone-induced central serous chorioretinopathy in mice.
Journal: Neuropharmacology | Authors: Qiaoli Liu - Spinal astrocyte-derived M-CSF mediates microglial reaction and drives visceral hypersensitivity following DSS-induced colitis
Journal: Neuropharmacology | Authors: Ke Wu | Species: mouse | Application: WB - Rap1GAP exacerbates myocardial infarction by regulating the AMPK/SIRT1/NF-κB signaling pathway
Journal: Cell Signal | Authors: Tiantian Shan | Species: rat | Application: WB,IHC - p16INK4a Deletion Alleviated Obesity-Associated Kidney Fibrosis by Regulating Metabolic Reprogramming and the Inflammasome Pathway
Journal: J Cell Mol Med | Authors: Qian Liu | Species: mouse | Application: WB,IHC - Transcriptomics and Network Pharmacology Reveal Anti-Inflammatory and Anti-Oxidative Stress Mechanisms of Qingxuan Runmu Yin in Dry Eye Disease.
Journal: J Inflamm Res | Authors: Shanshan Zhao | Species: human | Application: WB - Chitosan/Sodium Alginate/Velvet Antler Blood Peptides Hydrogel Promotes Diabetic Wound Healing via Regulating Angiogenesis, Inflammatory Response and Skin Flora
Journal: J Inflamm Res | Authors: Mingqian Hao | Species: mouse | Application: WB - Dihydromyricetin Modulates Neuropathic Pain and Depression: A Correlation with Hippocampal Vascular Endothelial Growth Factor in Mice.
Journal: J Inflamm Res | Authors: Tian Li | Species: mouse | Application: WB - Polystyrene microplastics mediate inflammatory responses in the chicken thymus by Nrf2/NF-κB pathway and trigger autophagy and apoptosis
Journal: Environ Toxicol Pharmacol | Authors: Junbo Li | Application: WB - Calcium phosphate cement with icariin-loaded gelatin microspheres as a local drug delivery system for bone regeneration
Journal: Biomed Eng Online | Authors: Ning Liu | Species: rabbit | Application: IHC - Exploration and Validation of Key Genes and Immune Infiltration in Alcoholic Hepatitis.
Journal: J Inflamm Res | Authors: Yingna Mei | Species: human | Application: WB - Polystyrene microplastics mediate inflammatory responses in the chicken thymus by Nrf2/NF-κB pathway and trigger autophagy and apoptosis
Journal: Environ Toxicol Pharmacol | Authors: Junbo Li | Application: WB - Heparanase-driven inflammation from the AGEs-stimulated macrophages changes the functions of glomerular endothelial cells.
Journal: Diabetes Res Clin Pract | Authors: Guang Xu | Species: mouse | Application: WB - Interleukin-1 Receptor-Associated Kinase-3 Aggravates Neuroinflammatory Injury After Intracerebral Hemorrhage via Activation NF-κB/IL-17A Pathway in Mice
Journal: J Inflamm Res | Authors: Jun Wang | Species: mouse | Application: WB - Angiotensin-(1-7) Modulates the Warburg Effect to Alleviate Inflammation in LPS-Induced Macrophages and Septic Mice
Journal: J Inflamm Res | Authors: Dan Yu | Species: mouse | Application: WB - Exploration and Validation of Key Genes and Immune Infiltration in Alcoholic Hepatitis.
Journal: J Inflamm Res | Authors: Yingna Mei | Species: human | Application: WB - Mastoparan M Suppressed NLRP3 Inflammasome Activation by Inhibiting MAPK/NF-κB and Oxidative Stress in Gouty Arthritis
Journal: J Inflamm Res | Authors: Yunbo Yan | Species: human | Application: WB - Mastoparan M Suppressed NLRP3 Inflammasome Activation by Inhibiting MAPK/NF-κB and Oxidative Stress in Gouty Arthritis
Journal: J Inflamm Res | Authors: Yunbo Yan | Species: human | Application: WB - Heparanase-driven inflammation from the AGEs-stimulated macrophages changes the functions of glomerular endothelial cells.
Journal: Diabetes Res Clin Pract | Authors: Guang Xu | Species: mouse | Application: WB - Achyranthes bidentata polysaccharides alleviate endoplasmic reticulum stress in osteoarthritis via lncRNA NEAT1/miR-377-3p pathway
Journal: Biomed Pharmacother | Authors: Changlong Fu | Species: mouse | Application: WB - Toll-like receptor 4 deficiency alleviates lipopolysaccharide-induced intestinal barrier dysfunction
Journal: Biomed Pharmacother | Authors: Lianghui Zhan | Species: mouse | Application: WB - Tetrastigma hemsleyanum Diels et Gilg ameliorates lipopolysaccharide induced sepsis via repairing the intestinal mucosal barrier.
Journal: Biomed Pharmacother | Authors: Lianghui Zhan | Species: mouse | Application: WB - Hydroxyurea protects against diabetic cardiomyopathy by inhibiting inflammation and apoptosis.
Journal: Biomed Pharmacother | Authors: Yu Zhou | Species: rat | Application: WB - Ziprasidone Induces Rabbit Atrium Arrhythmogenesis via Modification of Oxidative Stress and Sodium/Calcium Homeostasis.
Journal: Biomedicines | Authors: Buh-Yuan Tai | Application: WB - Xianling Lianxia formula enhances the inhibitory effects of trastuzumab on HER2-positive breast cancer
Journal: Acta Biochim Biophys Sin (Shanghai) | Authors: Feifei Li | Species: mouse | Application: IHC - Protective Effect and Mechanism of L-Theanine on Acute Alcoholic Liver Injury in Mice
Journal: Mol Nutr Food Res | Authors: Meng-Yuan Liu | Species: mouse | Application: WB - Saccharomyces boulardii Alleviates Ovalbumin-Induced Pyroptosis Through Cyba and IL-17 Signaling Pathway
Journal: Mol Nutr Food Res | Authors: Zhifeng Chen | Species: human | Application: WB - Enriched environment mitigates depressive behavior by changing the inflammatory activation phenotype of microglia in the hippocampus of depression model rats.
Journal: Brain Res Bull | Authors: Jing-Yang Gu | Species: rat | Application: WB - Long-Term Immunogenicity and In Vitro Prophylactic Protective Efficacy of M. tuberculosis Fusion Protein DR2 Combined with Liposomal Adjuvant DIMQ as a Boosting Vaccine for BCG
Journal: ACS Infect Dis | Authors: Li-Rong Mao | Species: mouse | Application: WB - Trans-10-hydroxy-2-decenoic acid protects against LPS-induced neuroinflammation through FOXO1-mediated activation of autophagy.
Journal: Eur J Nutr | Authors: Mengmeng You | Species: mouse | Application: WB - MST4 modulates the neuro-inflammatory response by regulating IκBα signaling pathway and affects the early outcome of experimental ischemic stroke in mice.
Journal: Brain Res Bull | Authors: Di Luan | Species: mouse | Application: WB - Inflammation-responsive biomimetic nanoparticles with epigallocatechin-3-gallate for acute lung injury therapy via autophagy enhancement
Journal: iScience | Authors: Ying Han | Species: mouse | Application: IHC - Inhibition of Noncanonical Ca 2+ Oscillation/Calcineurin/GSK-3β Pathway Contributes to Anti-Inflammatory Effect of Sigma-1 Receptor Activation
Journal: Neurochem Res | Authors: Tianyu Gao | Species: mouse | Application: WB - KPT-330 alleviates osteoarthritis by inhibiting subchondral bone osteoclastogenesis via the NF-κB and MAPK signaling pathways.
Journal: iScience | Authors: Wugui Chen - scAAV9-VEGF-165 inhibits neuroinflammatory response and invasion of macrophages into the peripheral nervous system of ALS transgenic mice.
Journal: Brain Res Bull | Authors: Ying Wang | Species: mouse | Application: WB,IF - Inhibition of Noncanonical Ca 2+ Oscillation/Calcineurin/GSK-3β Pathway Contributes to Anti-Inflammatory Effect of Sigma-1 Receptor Activation
Journal: Neurochem Res | Authors: Tianyu Gao | Species: mouse | Application: WB - Integrative Transcriptomics and Machine Learning Reveal the Association of CBX4 with Inflammation in Ulcerative Colitis as a Potential Epigenetic Regulator.
Journal: Biomedicines | Authors: Xiaohan Ma | Species: mouse,human | Application: WB,IHC - Interleukin-27 is a multitarget regulator of fibroblast remodeling in thyroid-associated ophthalmopathy.
Journal: iScience | Authors: Pengbo Zhang | Species: human | Application: IHC - Saccharomyces boulardii Alleviates Ovalbumin-Induced Pyroptosis Through Cyba and IL-17 Signaling Pathway
Journal: Mol Nutr Food Res | Authors: Zhifeng Chen | Species: human | Application: WB - Role of the Peli1-RIPK1 Signaling Axis in Methamphetamine-Induced Neuroinflammation
Journal: ACS Chem Neurosci | Authors: Weixiao Xu | Species: mouse | Application: WB - Long-Term Immunogenicity and In Vitro Prophylactic Protective Efficacy of M. tuberculosis Fusion Protein DR2 Combined with Liposomal Adjuvant DIMQ as a Boosting Vaccine for BCG
Journal: ACS Infect Dis | Authors: Li-Rong Mao | Species: mouse | Application: WB - Oxypeucedanin hydrate alleviates rheumatoid arthritis by inhibiting the TLR4-MD2/NF-κB/MAPK signaling axis
Journal: Acta Biochim Biophys Sin (Shanghai) | Authors: Mengdan Liu | Species: rat | Application: WB - Cyanidin Chloride Improves LPS-Induced Depression-Like Behavior in Mice by Ameliorating Hippocampal Inflammation and Excitotoxicity
Journal: ACS Chem Neurosci | Authors: Di Qu | Species: mouse,human | Application: WB - Enriched environment mitigates depressive behavior by changing the inflammatory activation phenotype of microglia in the hippocampus of depression model rats.
Journal: Brain Res Bull | Authors: Jing-Yang Gu | Species: rat | Application: WB - Induced neural stem cells suppressed neuroinflammation by inhibiting the microglial pyroptotic pathway in intracerebral hemorrhage rats
Journal: iScience | Authors: Jiaxin Liu | Species: rat | Application: WB - Immunomodulatory and Anti-Inflammatory Effects of Phycocyanin Oligopeptide Combined with Selenium and Zinc in LPS-Induced Mice.
Journal: Biomedicines | Authors: Kazim Sahin | Species: mouse | Application: WB - Dietary eicosapentaenoic acid normalizes hippocampal omega-3 and 6 polyunsaturated fatty acid profile, attenuates glial activation and regulates BDNF function in a rodent model of neuroinflammation induced by central interleukin-1β administration.
Journal: Eur J Nutr | Authors: Yilong Dong | Species: rat | Application: WB - Induced neural stem cells suppressed neuroinflammation by inhibiting the microglial pyroptotic pathway in intracerebral hemorrhage rats
Journal: iScience | Authors: Jiaxin Liu | Species: rat | Application: WB - MST4 modulates the neuro-inflammatory response by regulating IκBα signaling pathway and affects the early outcome of experimental ischemic stroke in mice.
Journal: Brain Res Bull | Authors: Di Luan | Species: mouse | Application: WB - Protective mechanisms of Agrimonia pilosa Ledeb in dextran sodium sulfate-induced colitis as determined by a network pharmacology approach.
Journal: Acta Biochim Biophys Sin (Shanghai) | Authors: Chen Li | Species: mouse | Application: IHC - Xianling Lianxia formula enhances the inhibitory effects of trastuzumab on HER2-positive breast cancer
Journal: Acta Biochim Biophys Sin (Shanghai) | Authors: Feifei Li | Species: mouse | Application: IHC - QHRD106 ameliorates ischemic stroke injury as a long-acting tissue kallikrein preparation
Journal: iScience | Authors: Si-Yi Xu | Species: mouse | Application: WB - Dexmedetomidine Inhibits Neuroinflammation by Altering Microglial M1/M2 Polarization Through MAPK/ERK Pathway.
Journal: Neurochem Res | Authors: Zhengguo Qiu | Species: mouse | Application: WB - Magnesium-L-threonate alleviate colonic inflammation and memory impairment in chronic-plus-binge alcohol feeding mice.
Journal: Brain Res Bull | Authors: Chang Liu | Species: mouse | Application: WB - Dendrobine attenuates postoperative cognitive dysfunction by inhibiting Runx1-mediated NF-κB signaling pathway.
Journal: Brain Res Bull | Authors: Dong Ji | Species: mouse | Application: WB - QHRD106 ameliorates ischemic stroke injury as a long-acting tissue kallikrein preparation
Journal: iScience | Authors: Si-Yi Xu | Species: mouse | Application: WB - Xianling Lianxia formula enhances the inhibitory effects of trastuzumab on HER2-positive breast cancer
Journal: Acta Biochim Biophys Sin (Shanghai) | Authors: Feifei Li | Species: mouse | Application: IHC - Agaricus blazei Murrill Polysaccharide Attenuates Periodontitis via H2 S/NRF2 Axis-Boosted Appropriate Level of Autophagy in PDLCs
Journal: Mol Nutr Food Res | Authors: Wenxiu Yuan | Species: human | Application: WB,IF - Integrated single-cell and spatial transcriptomics reveal microenvironment disruptions by androgen in mouse ovary
Journal: iScience | Authors: Man Luo | Species: human | Application: WB - Protective Effect and Mechanism of L-Theanine on Acute Alcoholic Liver Injury in Mice
Journal: Mol Nutr Food Res | Authors: Meng-Yuan Liu | Species: mouse | Application: WB - Xianling Lianxia formula enhances the inhibitory effects of trastuzumab on HER2-positive breast cancer
Journal: Acta Biochim Biophys Sin (Shanghai) | Authors: Feifei Li | Species: mouse | Application: IHC - Renal inflammation combined with renal function reserve reduction accelerate kidney aging via pentose phosphate pathway
Journal: iScience | Authors: Bing Han | Species: rat | Application: WB - Molecular mechanism of resveratrol promoting differentiation of preosteoblastic MC3T3-E1 cells based on network pharmacology and experimental validation
Journal: BMC Complement Med Ther | Authors: Yu He | Species: mouse | Application: WB - Autophagy Contributes to the Rapamycin-Induced Improvement of Otitis Media.
Journal: Front Cell Neurosci | Authors: Daoli Xie | Species: mouse | Application: IF - Targeting MAPK Pathways by Naringenin Modulates Microglia M1/M2 Polarization in Lipopolysaccharide-Stimulated Cultures.
Journal: Front Cell Neurosci | Authors: Bei Zhang | Species: mouse | Application: IF - Autophagy Contributes to the Rapamycin-Induced Improvement of Otitis Media.
Journal: Front Cell Neurosci | Authors: Daoli Xie | Species: mouse | Application: IF - Ethanol extract of Paridis rhizoma attenuates carrageenan-induced paw swelling in rats by inhibiting the production of inflammatory factors
Journal: BMC Complement Med Ther | Authors: Li Xiang | Species: mouse | Application: WB - Ursolic Acid Ameliorates Spinal Cord Injury in Mice by Regulating Gut Microbiota and Metabolic Changes.
Journal: Front Cell Neurosci | Authors: Zi-Jie Rong | Species: mouse | Application: WB - The effect of a chrysanthemum water extract in protecting the retina of mice from light damage
Journal: BMC Complement Med Ther | Authors: Yibo Gong | Species: mouse | Application: IF - Molecular mechanism of resveratrol promoting differentiation of preosteoblastic MC3T3-E1 cells based on network pharmacology and experimental validation
Journal: BMC Complement Med Ther | Authors: Yu He | Species: mouse | Application: WB - Network pharmacology and in vivo evidence of the pharmacological mechanism of geniposide in the treatment of atherosclerosis
Journal: BMC Complement Med Ther | Authors: Guiping Ma | Species: mouse | Application: WB - Molecular mechanism of resveratrol promoting differentiation of preosteoblastic MC3T3-E1 cells based on network pharmacology and experimental validation
Journal: BMC Complement Med Ther | Authors: Yu He | Species: mouse | Application: WB - Red Nucleus Interleukin-6 Evokes Tactile Allodynia in Male Rats Through Modulating Spinal Pro-inflammatory and Anti-inflammatory Cytokines.
Journal: Front Mol Neurosci | Authors: Qing-Qing Yang | Species: rat | Application: WB - Network pharmacology and in vivo evidence of the pharmacological mechanism of geniposide in the treatment of atherosclerosis
Journal: BMC Complement Med Ther | Authors: Guiping Ma | Species: mouse | Application: WB - Zinc-Mediated Endoplasmic Reticulum Stress and Metallothionein Alleviate Arsenic-Induced Cardiotoxicity in Cyprinus Carpio
Journal: Biol Trace Elem Res | Authors: Haiyan Dong - TAT-beclin1 treatment accelerates the development of atherosclerotic lesions in ApoE-deficient mice
Journal: FASEB J | Authors: Lianbo Liu | Species: mouse | Application: IF - A-Lipoic Acid Alleviates Folic Acid-Induced Renal Damage Through Inhibition of Ferroptosis.
Journal: Front Physiol | Authors: Xue Li | Species: mouse | Application: WB,IHC - The Activation of Heat-Shock Protein After Copper(II) and/or Arsenic(III)-Induced Imbalance of Homeostasis, Inflammatory Response in Chicken Rectum.
Journal: Biol Trace Elem Res | Authors: Xin Yang | Application: WB - C/EBPγ is a critical negative regulator of LPS-/IgG immune complex-induced acute lung injury through the downregulation of C/EBPβ-/C/EBPδ-dependent C/EBP transcription activation.
Journal: FASEB J | Authors: Chunguang Yan | Species: mouse | Application: WB - Dimethyl Itaconate Attenuates Osteoarthritis by Suppressing Macrophage Chemotaxis and TLR2/NF-κB/NLRP3-Mediated Pyroptosis: Evidence From Transcriptome and Functional Validation.
Journal: FASEB J | Authors: Xufeng Li | Species: rat | Application: WB,IF - Calcium Fructoborate Improves Knee Osteoarthritis in Rats by Activating Hedgehog Signaling Through DDIT3
Journal: Biol Trace Elem Res | Authors: TingXin Yan | Species: rat,human | Application: WB,IF - Exercise Capacity Is Improved by Levosimendan in Heart Failure and Sarcopenia via Alleviation of Apoptosis of Skeletal Muscle.
Journal: Front Physiol | Authors: Di Wang | Species: mouse | Application: IHC - Succinate Mediates Immune-Angiogenic Response by Activating Macrophage M2 Polarization in Oxygen-Induced Retinopathy.
Journal: FASEB J | Authors: Tianyi Shen | Species: mouse | Application: WB - Dimethyl Itaconate Attenuates Osteoarthritis by Suppressing Macrophage Chemotaxis and TLR2/NF-κB/NLRP3-Mediated Pyroptosis: Evidence From Transcriptome and Functional Validation.
Journal: FASEB J | Authors: Xufeng Li | Species: rat | Application: WB,IF - Gout-associated uric acid crystals induce tophi ulcerations and impair wound healing in a novel gouty ulcer model.
Journal: Wound Repair Regen | Authors: Wu Bao | Species: rat | Application: WB - LAPTM5 Promotes Age-Related Renal Fibrosis via USP10/PTEN-Mediated Autophagy Inhibition.
Journal: FASEB J | Authors: Yan Wang | Species: human | Application: WB - Exosomes from high glucose-treated macrophages activate glomerular mesangial cells via TGF-β1/Smad3 pathway in vivo and in vitro.
Journal: FASEB J | Authors: Qi-Jin Zhu | Species: mouse | Application: WB - Hypoxia-inducible factor prolyl hydroxylase inhibitor alleviates heatstroke-induced acute kidney injury by activating BNIP3-mediated mitophagy
Journal: FASEB J | Authors: Ling Wang | Species: mouse,human | Application: WB - Chronic Intermittent Hypobaric Hypoxia Decreases High Blood Pressure by Stabilizing the Vascular Renin-Angiotensin System in Spontaneously Hypertensive Rats.
Journal: Front Physiol | Authors: Hua Chen | Species: rat | Application: IHC - LAPTM5 Promotes Age-Related Renal Fibrosis via USP10/PTEN-Mediated Autophagy Inhibition.
Journal: FASEB J | Authors: Yan Wang | Species: human | Application: WB - Dimethyl Itaconate Attenuates Osteoarthritis by Suppressing Macrophage Chemotaxis and TLR2/NF-κB/NLRP3-Mediated Pyroptosis: Evidence From Transcriptome and Functional Validation.
Journal: FASEB J | Authors: Xufeng Li | Species: rat | Application: WB,IF - Succinate Mediates Immune-Angiogenic Response by Activating Macrophage M2 Polarization in Oxygen-Induced Retinopathy.
Journal: FASEB J | Authors: Tianyi Shen | Species: mouse | Application: WB - The Activation of Heat-Shock Protein After Copper(II) and/or Arsenic(III)-Induced Imbalance of Homeostasis, Inflammatory Response in Chicken Rectum.
Journal: Biol Trace Elem Res | Authors: Xin Yang | Application: WB - Renal CD81 interacts with sodium potassium 2 chloride cotransporter and sodium chloride cotransporter in rats with lipopolysaccharide-induced preeclampsia
Journal: FASEB J | Authors: Ping Wang | Species: rat | Application: WB - NF-κB-mediated inflammation correlates with calcium overload under arsenic trioxide-induced myocardial damage in Gallus gallus.
Journal: Chemosphere | Authors: Siwen Li | Application: WB - Collagen-EGCG Combination Synergistically Prevents UVB-Induced Skin Photoaging in Nude Mice
Journal: Macromol Biosci | Authors: Zhiqiang Fan | Species: mouse | Application: WB - Microglia-derived TNF-α inhibiting GABAergic neurons in the anterior lateral bed nucleus of the stria terminalis precipitates visceral hypersensitivity induced by colorectal distension in rats.
Journal: Neurobiol Stress | Authors: Ning-Ning Ji | Species: rat | Application: WB - Pinocembrin alleviates renal ischemia-reperfusion injury/unilateral ureteral obstruction (UUO)-generated renal fibrosis by targeting the CYP1B1/ROS/MAPK axis
Journal: FEBS J | Authors: Bang-Hua Zhang | Species: mouse,human | Application: WB - Growth Differentiation Factor 15 Inhibits Cardiac Fibrosis, Oxidative Stress, Inflammation, and Apoptosis in a Rat Model of Heart Failure with Preserved Ejection Fraction
Journal: Front Biosci (Landmark Ed) | Authors: Xuyang Meng | Species: rat | Application: WB - Astragaloside IV-PESV inhibits prostate cancer tumor growth by restoring gut microbiota and microbial metabolic homeostasis via the AGE-RAGE pathway
Journal: BMC Cancer | Authors: Xujun You | Species: mouse | Application: WB - SIRT2 Alleviates Chronic Cold Stress-Induced Lung Injury by Regulating Lung Macrophage M1 Polarization.
Journal: Curr Issues Mol Biol | Authors: Bin Xu | Species: mouse | Application: WB - Astragaloside IV-PESV inhibits prostate cancer tumor growth by restoring gut microbiota and microbial metabolic homeostasis via the AGE-RAGE pathway
Journal: BMC Cancer | Authors: Xujun You | Species: mouse | Application: WB - LncRNA SOX2OT facilitates LPS-induced inflammatory injury by regulating intercellular adhesion molecule 1 (ICAM1) via sponging miR-215-5p.
Journal: Clin Immunol | Authors: Wangliang Zhu | Species: human | Application: WB - HuR-HuB autoregulatory network governs inflammatory factors expression.
Journal: J Biol Chem | Authors: Xingyue Fu | Species: mouse,human | Application: WB - SIRT2 Alleviates Chronic Cold Stress-Induced Lung Injury by Regulating Lung Macrophage M1 Polarization.
Journal: Curr Issues Mol Biol | Authors: Bin Xu | Species: mouse | Application: WB - Polystyrene Microplastics and Bisphenol A Exposure Worsen Intestinal Injury in Diabetic Mice by Disrupting Gut Microbiota and Metabolites.
Journal: Chem Res Toxicol | Authors: Ying Zhang | Species: mouse | Application: WB - Exercise Attenuate Diaphragm Atrophy in COPD Mice via Inhibiting the RhoA/ROCK Signaling
Journal: Int J Chron Obstruct Pulmon Dis | Authors: Peijun Li | Species: mouse | Application: WB - Self-assembled cyanidin-3-O-glucoside nanoparticles alleviate inflammation and ferroptosis induced by PRRSV infection.
Journal: J Virol | Authors: Xiaohan Chen | Species: pig | Application: WB - Polychlorinated Biphenyl Quinone Promotes Atherosclerosis through Lipid Accumulation and Endoplasmic Reticulum Stress via CD36.
Journal: Chem Res Toxicol | Authors: Bingwei Yang | Species: mouse | Application: WB - Construction of a mouse model for sensitive skin research
Journal: Contact Dermatitis | Authors: Bingli Huang | Species: mouse | Application: IHC - Oxidative stress and inflammation combine to exacerbate cochlear damage and sensorineural hearing loss in C57BL/6 mice
Journal: Front Neurosci | Authors: Zhongwu Su | Species: mouse | Application: IF - Neuro death through autophagy via the acetylation of FoxO1 by SIRT2 in the hippocampus of mice in a autism spectrum disorder mice model
Journal: J Cell Physiol | Authors: Lanmin Guo | Species: mouse | Application: WB - Fucoidan inhibits tooth movement by promoting restorative macrophage polarization through the STAT3 pathway.
Journal: J Cell Physiol | Authors: Shuting Zhang | Species: mouse | Application: WB - The integrated treatment of photodynamic therapy and oncolytic Virotherapy: A dual-modal paradigm for breast Cancer.
Journal: J Photochem Photobiol B | Authors: Yixiang Li | Species: mouse | Application: WB, IHC - Knockdown of ADAMDEC1 ameliorates ox-LDL-induced endothelial cell injury and atherosclerosis progression
Journal: Funct Integr Genomics | Authors: Xiaochen Wang | Species: human | Application: WB - Integrating UPLC-HR-MS, network pharmacology and experimental validation to reveal the potential mechanism of Fuzheng Bixie granules in treating acute lung injury.
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Luyin Yang | Species: mouse | Application: WB - Dl-3-n-Butylphthalide Reduces Cognitive Deficits and Alleviates Neuropathology in P301S Tau Transgenic Mice.
Journal: Front Neurosci | Authors: Yanmin Chang | Species: mouse | Application: WB - A network pharmacology-based study on the mechanism of hirudin attenuates renal interstitial fibrosis through Nrf2 and NF-κB signalling pathways.
Journal: Naunyn Schmiedebergs Arch Pharmacol | Authors: Kang Yang | Species: human | Application: WB - Neuroprotective Effect of Ketone Metabolism on Inhibiting Inflammatory Response by Regulating Macrophage Polarization After Acute Cervical Spinal Cord Injury in Rats.
Journal: Front Neurosci | Authors: Junyu Lin | Species: rat | Application: WB - Knockdown of ADAMDEC1 ameliorates ox-LDL-induced endothelial cell injury and atherosclerosis progression
Journal: Funct Integr Genomics | Authors: Xiaochen Wang | Species: human | Application: WB - Dl-3-n-Butylphthalide Reduces Cognitive Deficits and Alleviates Neuropathology in P301S Tau Transgenic Mice.
Journal: Front Neurosci | Authors: Yanmin Chang | Species: mouse | Application: WB - Neuro death through autophagy via the acetylation of FoxO1 by SIRT2 in the hippocampus of mice in a autism spectrum disorder mice model
Journal: J Cell Physiol | Authors: Lanmin Guo | Species: mouse | Application: WB - Hesperidin mitigates oxidative stress-induced ferroptosis in nucleus pulposus cells via Nrf2/NF-κB axis to protect intervertebral disc from degeneration
Journal: Cell Cycle | Authors: Jian Zhu | Application: WB - Effects of carotid baroreceptor stimulation on aortic remodeling in obese rats.
Journal: Nutr Metab Cardiovasc Dis | Authors: Qiao Yu | Species: rat | Application: WB - Protective effect of homogeneous polysaccharides of Wuguchong (HPW) on intestinal mucositis induced by 5-fluorouracil in mice.
Journal: Nutr Metab (Lond) | Authors: Peng Shi | Species: mouse | Application: WB - Effects of carotid baroreceptor stimulation on aortic remodeling in obese rats.
Journal: Nutr Metab Cardiovasc Dis | Authors: Qiao Yu | Species: rat | Application: WB - Streptococcus uberis induced expressions of pro-inflammatory IL-6, TNF-α, and IFN-γ in bovine mammary epithelial cells associated with inhibited autophagy and autophagy flux formation
Journal: Microb Pathog | Authors: Sohrab Khan | Species: bovine | Application: WB - Endogenous blocking of TLR2 along with TNF-α and IL-1β ameliorates the severity of the S. aureus arthritis via modulating STAT3/SOCS3 expressions in tissue resident macrophages
Journal: Microb Pathog | Authors: Rituparna Ghosh | Species: mouse,human | Application: WB - The Role of Grifola frondosa Polysaccharide in Preventing Skeletal Muscle Atrophy in Type 2 Diabetes Mellitus
Journal: Life (Basel) | Authors: Ying She | Application: WB - Hesperidin mitigates oxidative stress-induced ferroptosis in nucleus pulposus cells via Nrf2/NF-κB axis to protect intervertebral disc from degeneration
Journal: Cell Cycle | Authors: Jian Zhu | Application: WB - Baicalin ameliorates cigarette smoke-induced airway inflammation in rats by modulating HDAC2/NF-κB/PAI-1 signalling.
Journal: Pulm Pharmacol Ther | Authors: Hu Zhang | Species: human | Application: WB - Up-regulation of PPAR-γ involved in the therapeutic effect of icariin on cigarette smoke-induced inflammation
Journal: Pulm Pharmacol Ther | Authors: Qiuping Li | Species: human | Application: WB - Adipose-derived exosomes protect the pulmonary endothelial barrier in ventilator-induced lung injury by inhibiting the TRPV4/Ca2+ signaling pathway.
Journal: Am J Physiol Lung Cell Mol Physiol | Authors: Qian Yu | Species: mouse | Application: WB - Potential of nobiletin against Alzheimer's disease through inhibiting neuroinflammation.
Journal: Metab Brain Dis | Authors: Wen Chai | Species: mouse | Application: WB - Liposome of Phlorizin promote the repair of carotid atherosclerosis in rats by regulating inflammation and the Nrf2 signaling pathway
Journal: Biochim Biophys Acta Mol Cell Biol Lipids | Authors: Xiaoyu Wu | Species: rat | Application: WB - PMAIP1 mediates endoplasmic reticulum stress in human dental pulp stem cells during pulpitis pathogenesis
Journal: BMC Oral Health | Authors: Caixia Zhou - Reactive oxygen species-associated molecular landscape uncovers diagnostic and immune features in osteoarthritis.
Journal: J Orthop Surg Res | Authors: Jiawei Zhou | Species: rat | Application: WB - Xanthoxylin Regulating the Inflammatory Microenvironment After Spinal Cord Injury Through Inhibition of the NF-κB Signaling Pathway.
Journal: Neuromolecular Med | Authors: Zihao Fan | Species: mouse | Application: WB - Disruption of P2X4 purinoceptor and suppression of the inflammation associated with cerebral aneurysm formation.
Journal: J Neurosurg | Authors: Miyuki Fukuda | Species: rat | Application: WB - Wuzi Yanzong Pill relieves MPTP-induced motor dysfunction and neuron loss by inhibiting NLRP3 inflammasome-mediated neuroinflammation
Journal: Metab Brain Dis | Authors: Tao Pan | Species: mouse | Application: WB - PMAIP1 mediates endoplasmic reticulum stress in human dental pulp stem cells during pulpitis pathogenesis
Journal: BMC Oral Health | Authors: Caixia Zhou - Baicalin ameliorates cigarette smoke-induced airway inflammation in rats by modulating HDAC2/NF-κB/PAI-1 signalling.
Journal: Pulm Pharmacol Ther | Authors: Hu Zhang | Species: human | Application: WB - The regulatory mechanism of cyclic GMP-AMP synthase on inflammatory senescence of nucleus pulposus cell
Journal: J Orthop Surg Res | Authors: Rui Sun | Species: rat | Application: WB - Reactive oxygen species-associated molecular landscape uncovers diagnostic and immune features in osteoarthritis.
Journal: J Orthop Surg Res | Authors: Jiawei Zhou | Species: rat | Application: WB - Comprehensive multiomic analysis of extracellular vesicles from Mycoplasma bovis-infected bovine mammary epithelial cells identifies proteins and miRNAs that induce inflammatory responses in macrophages
Journal: Vet Res | Authors: Yiming Wu | Application: WB,IF - Paeonol ameliorates CFA-induced inflammatory pain by inhibiting HMGB1/TLR4/NF-κB p65 pathway.
Journal: Metab Brain Dis | Authors: Chen Qiu | Species: mouse | Application: WB - Potential of nobiletin against Alzheimer's disease through inhibiting neuroinflammation.
Journal: Metab Brain Dis | Authors: Wen Chai | Species: mouse | Application: WB - Adipose-derived exosomes protect the pulmonary endothelial barrier in ventilator-induced lung injury by inhibiting the TRPV4/Ca2+ signaling pathway.
Journal: Am J Physiol Lung Cell Mol Physiol | Authors: Qian Yu | Species: mouse | Application: WB - Mechanisms by which SIRT2 modulates alveolar macrophage immunoreactivity to intervene in Actinobacillus pleuropneumoniae infection in piglets under cold stimulation.
Journal: Vet Res | Authors: Rongge Xia | Species: pig | Application: WB - Xanthoxylin Regulating the Inflammatory Microenvironment After Spinal Cord Injury Through Inhibition of the NF-κB Signaling Pathway.
Journal: Neuromolecular Med | Authors: Zihao Fan | Species: mouse | Application: WB - Potential of nobiletin against Alzheimer's disease through inhibiting neuroinflammation.
Journal: Metab Brain Dis | Authors: Wen Chai | Species: mouse | Application: WB - LongShengZhi capsule inhibits doxorubicin-induced heart failure by anti-oxidative stress.
Journal: Biomed Pharmacother | Authors: Shuai Xu | Species: rat | Application: WB - Antihypertensive and renal protective effect of Shunaoxin pill combined with captopril on spontaneous hypertension rats.
Journal: Biomed Pharmacother | Authors: Shuli Man | Species: mouse | Application: WB - Branched-chain amino acids alleviate Parkinson's neurodegeneration via microbial propionate-dependent restoration of the PI3K/Akt/mTORC1 axis.
Journal: Mol Immunol | Authors: Na Mi | Species: mouse,human | Application: WB - Jujuboside A ameliorates cognitive deficiency in delirium through promoting hippocampal E4BP4 in mice
Journal: J Pharm Pharmacol | Authors: Jianhao Du | Species: mouse | Application: WB - Branched-chain amino acids alleviate Parkinson's neurodegeneration via microbial propionate-dependent restoration of the PI3K/Akt/mTORC1 axis.
Journal: Mol Immunol | Authors: Na Mi | Species: mouse,human | Application: WB - Progesterone Enhances the Invasion of Trophoblast Cells by Activating PI3K/AKT Signaling Pathway to Prevent Preeclampsia
Journal: Cell Transplant | Authors: Hongyu Liu | Species: rat | Application: WB - Alterations in the jejunal microbiota and fecal metabolite profiles of rabbits infected with Eimeria intestinalis.
Journal: Parasit Vectors | Authors: Xu Yuan | Application: IHC - Jujuboside A ameliorates cognitive deficiency in delirium through promoting hippocampal E4BP4 in mice
Journal: J Pharm Pharmacol | Authors: Jianhao Du | Species: mouse | Application: WB - Strontium Ranelate Ameliorates Intervertebral Disc Degeneration via Regulating TGF-β1/NF-κB Axis
Journal: Int J Med Sci | Authors: Ruping Sun | Species: human | Application: WB - Dietary pterostilbene supplementation attenuates intestinal damage and immunological stress of broiler chickens challenged with lipopolysaccharide1.
Journal: J Anim Sci | Authors: Hao Zhang | Application: WB - Branched-chain amino acids alleviate Parkinson's neurodegeneration via microbial propionate-dependent restoration of the PI3K/Akt/mTORC1 axis.
Journal: Mol Immunol | Authors: Na Mi | Species: mouse,human | Application: WB - Synergistic therapeutic effect of parecoxib and ilomastat combination in osteoarthritis via inhibition of IL-17/PI3K/AKT/NF-κB activity
Journal: Mol Immunol | Authors: Xiaofei Feng | Species: human | Application: WB - Liraglutide combined with dapagliflozin treatment improves myocardial disease and endothelial dysfunction in T2DM mice.
Journal: J Diabetes Investig | Authors: An-Jun Tan - Rosmarinic acid exerts a neuroprotective effect on spinal cord injury by suppressing oxidative stress and inflammation via modulating the Nrf2/HO-1 and TLR4/NF-κB pathways.
Journal: Toxicol Appl Pharmacol | Authors: Zhanjun Ma | Species: rat - Gentiopicroside Attenuated Dopaminergic Neurodegeneration via Inhibiting Neuroinflammatory Responses and Ferroptosis in Experimental Models of Parkinson's Disease
Journal: Basic Clin Pharmacol Toxicol | Authors: Fangling Sun | Species: rat,human | Application: WB - CircANKRD36 Knockdown Inhibits M1 Polarization and Inflammatory Response via miR-498/TXNRD1 in LPS-Stimulated Macrophages Under High Glucose Conditions.
Journal: J Biochem Mol Toxicol | Authors: Zhimao Ye | Species: human | Application: WB - Underlying Metabolic Syndrome Exacerbates Vibrio vulnificus-induced Acute Kidney Injury via Systemic Th17/Treg Dysregulation
Journal: Am J Physiol Renal Physiol | Authors: Madhura Pravin More | Application: IHC - Exosomal MicroRNA-181a Derived From Mesenchymal Stem Cells Improves Gut Microbiota Composition, Barrier Function, and Inflammatory Status in an Experimental Colitis Model.
Journal: Front Med (Lausanne) | Authors: Li Gu | Species: mouse | Application: WB - Pyridoxal-5'-Phosphate Promotes Immunomodulatory Function of Adipose-Derived Mesenchymal Stem Cells through Indoleamine 2,3-Dioxygenase-1 and TLR4/NF-κB Pathway.
Journal: Stem Cells Int | Authors: Cong Li | Species: human | Application: WB - The active ingredient of Evodia rutaecarpa reduces inflammation in knee osteoarthritis rats through blocking calcium influx and NF-κB pathway
Journal: Basic Clin Pharmacol Toxicol | Authors: Yan Gao | Species: rat | Application: WB - CircANKRD36 Knockdown Inhibits M1 Polarization and Inflammatory Response via miR-498/TXNRD1 in LPS-Stimulated Macrophages Under High Glucose Conditions.
Journal: J Biochem Mol Toxicol | Authors: Zhimao Ye | Species: human | Application: WB - Liraglutide combined with dapagliflozin treatment improves myocardial disease and endothelial dysfunction in T2DM mice.
Journal: J Diabetes Investig | Authors: An-Jun Tan - The Role of the Superior Cervical Sympathetic Ganglion in Ischemia Reperfusion-Induced Acute Kidney Injury in Rats.
Journal: Front Med (Lausanne) | Authors: Wencui Zhang | Species: rat | Application: WB - Akkermansia muciniphila promotes type H vessels formation and bone fracture healing by reducing gut permeability and inflammation.
Journal: Dis Model Mech | Authors: Jiang-Hua Liu | Species: mouse | Application: IF - Clinical discovery of anti-CYP2E1 autoantibodies and preclinical efficacy of a CYP2E1 inhibitor in rheumatoid arthritis.
Journal: Drug Metab Dispos | Authors: Liyuan Gao - The active ingredient of Evodia rutaecarpa reduces inflammation in knee osteoarthritis rats through blocking calcium influx and NF-κB pathway
Journal: Basic Clin Pharmacol Toxicol | Authors: Yan Gao | Species: rat | Application: WB - MOV10-mediated alternative splicing regulates mesangial cell proliferation in diabetic kidney disease.
Journal: Biochim Biophys Acta Gene Regul Mech | Authors: Qijia Wang - Pyridoxal-5'-Phosphate Promotes Immunomodulatory Function of Adipose-Derived Mesenchymal Stem Cells through Indoleamine 2,3-Dioxygenase-1 and TLR4/NF-κB Pathway.
Journal: Stem Cells Int | Authors: Cong Li | Species: human | Application: WB - Underlying Metabolic Syndrome Exacerbates Vibrio vulnificus-induced Acute Kidney Injury via Systemic Th17/Treg Dysregulation
Journal: Am J Physiol Renal Physiol | Authors: Madhura Pravin More | Application: IHC - MOV10-mediated alternative splicing regulates mesangial cell proliferation in diabetic kidney disease.
Journal: Biochim Biophys Acta Gene Regul Mech | Authors: Qijia Wang - Uric acid promotes interleukin-17 expression to cause kidney injury
Journal: J Biochem Mol Toxicol | Authors: Lina Yang | Species: rat | Application: WB - Clinical discovery of anti-CYP2E1 autoantibodies and preclinical efficacy of a CYP2E1 inhibitor in rheumatoid arthritis.
Journal: Drug Metab Dispos | Authors: Liyuan Gao - Pyridoxal-5'-Phosphate Promotes Immunomodulatory Function of Adipose-Derived Mesenchymal Stem Cells through Indoleamine 2,3-Dioxygenase-1 and TLR4/NF-κB Pathway.
Journal: Stem Cells Int | Authors: Cong Li | Species: human | Application: WB - Chronic acrylamide exposure induced glia cell activation, NLRP3 infl-ammasome upregulation and cognitive impairment.
Journal: Toxicol Appl Pharmacol | Authors: Ying Liu | Species: rat | Application: WB - Acacetin inhibits activation of microglia to improve neuroinflammation after subarachnoid hemorrhage through the PERK signaling pathway mediated autophagy
Journal: Hum Exp Toxicol | Authors: Ying Liu | Species: rat | Application: WB - The Ku protein family regulates hyperglycemia-induced vascular endothelial cell inflammation by modulating P300 levels
Journal: Exp Cell Res | Authors: Qinqin Cai | Species: mouse,human | Application: WB,IHC - Knockdown of GBP5 Attenuates Abdominal Aortic Aneurysm Formation via the NF-κB Pathway.
Journal: Appl Biochem Biotechnol | Authors: Yongsheng Wang | Species: mouse | Application: WB - Irisin Alleviates Impaired Mitochondrial Fusion via Enhancing PKA/SIRT3/mTOR Pathway in Hepatic Steatosis
Journal: J Gastroenterol Hepatol | Authors: Jia Li - Unveiling the Therapeutic Potential of Suyin Detoxification Prescription in Diabetic Nephropathy: A Comprehensive Study Integrating Clinical Efficacy, Network Pharmacology, and Molecular Mechanisms.
Journal: J Diabetes Res | Authors: Tuo Wei | Species: mouse | Application: WB - Knockdown of LINC01138 protects human chondrocytes against IL-1β-induced damage by regulating the hsa-miR-1207-5p/KIAA0101 axis
Journal: Immun Inflamm Dis | Authors: Jiangtao Zhang | Species: human | Application: WB - Knockdown of GBP5 Attenuates Abdominal Aortic Aneurysm Formation via the NF-κB Pathway.
Journal: Appl Biochem Biotechnol | Authors: Yongsheng Wang | Species: mouse | Application: WB - Adipose-derived mesenchymal stem cells ameliorate acute liver injury in rat model of CLP induced-sepsis via sTNFR1.
Journal: Exp Cell Res | Authors: Huoyan Liang | Species: rat | Application: WB - Effect of luteolin on oxidative stress and inflammation in the human osteoblast cell line hFOB1.19 in an inflammatory microenvironment
Journal: BMC Pharmacol Toxicol | Authors: Zhengjun Peng | Species: human | Application: WB - Macrophage CBX4 Potentiates Atherosclerosis by its SUMO E3 Ligase Activity
Journal: Cardiovasc Drugs Ther | Authors: Zhenyu Zhao | Species: mouse,human | Application: WB - Unveiling the Therapeutic Potential of Suyin Detoxification Prescription in Diabetic Nephropathy: A Comprehensive Study Integrating Clinical Efficacy, Network Pharmacology, and Molecular Mechanisms.
Journal: J Diabetes Res | Authors: Tuo Wei | Species: mouse | Application: WB - Astragaloside IV Improves Cognitive Impairment by Reducing β-Amyloid and Tau Protein Deposition in Hippocampal Tissue of db/db Mice: A PET/CT Imaging-Based Study
Journal: Diabetes Metab Syndr Obes | Authors: Lei Jiang - Forsythiaside A attenuates sepsis-induced acute lung injury by suppressing EGR1/GLS2-mediated ferroptosis-associated lipid peroxidation.
Journal: Exp Cell Res | Authors: Xingjie Chang - Bifenthrin exacerbates ulcerative colitis via immunotoxicity: network toxicology and experimental validation reveal novel therapeutic targets.
Journal: BMC Pharmacol Toxicol | Authors: Lingxiao Wang - Effect of luteolin on oxidative stress and inflammation in the human osteoblast cell line hFOB1.19 in an inflammatory microenvironment
Journal: BMC Pharmacol Toxicol | Authors: Zhengjun Peng | Species: human | Application: WB - The preoperative neutrophil-to-lymphocyte ratio is not a marker of prostate cancer characteristics but is an independent predictor of biochemical recurrence in patients receiving radical prostatectomy.
Journal: Cancer Med | Authors: Zhi Cao | Species: human | Application: IHC - Protective effects of Astragalin on spermatogenesis in streptozotocin-induced diabetes in male mice by improving antioxidant activity and inhibiting inflammation.
Journal: Biomed Pharmacother | Authors: Xiao-Xu Han | Species: mouse | Application: WB - Administration of methyl palmitate prevents non-alcoholic steatohepatitis (NASH) by induction of PPAR-α.
Journal: Biomed Pharmacother | Authors: Li Zhang | Species: mouse | Application: WB - CAPE-pNO2 attenuates diabetic cardiomyopathy through the NOX4/NF-κB pathway in STZ-induced diabetic mice.
Journal: Biomed Pharmacother | Authors: Lu Fan | Species: mouse | Application: WB - Gut microbiome-derived lactate promotes to anxiety-like behaviors through GPR81 receptor-mediated lipid metabolism pathway.
Journal: Psychoneuroendocrinology | Authors: Baixi Shan | Species: rat | Application: WB,IF - Scorpion Venom Analgesic Peptide, BmK AGAP Inhibits Stemness, and Epithelial-Mesenchymal Transition by Down-Regulating PTX3 in Breast Cancer.
Journal: Front Oncol | Authors: Sylvanus Kampo | Species: human | Application: WB - CALR-TLR4 Complex Inhibits Non-Small Cell Lung Cancer Progression by Regulating the Migration and Maturation of Dendritic Cells.
Journal: Front Oncol | Authors: Ruo Chen | Species: human | Application: WB - Depletion of regulatory T cells exacerbates inflammatory responses after chronic cerebral hypoperfusion in mice
Journal: Mol Cell Neurosci | Authors: Yao Wang | Species: mouse | Application: WB - Diet Control and Swimming Exercise Ameliorate HFD-Induced Cognitive Impairment Related to the SIRT1-NF-κB/PGC-1α Pathways in ApoE-/- Mice
Journal: Neural Plast | Authors: Wei Wei | Species: mouse | Application: WB - VCAM1 Drives Vascular Inflammation Leading to Continuous Cortical Neuronal Loss Following Chronic Cerebral Hypoperfusion
Journal: J Alzheimers Dis | Authors: Ruihua Sun | Species: rat | Application: WB - Sphingosine-1-phosphate receptor 3 promotes neuronal apoptosis via the TNF-α/caspase-3 signaling pathway after acute intracerebral hemorrhage
Journal: Mol Cell Neurosci | Authors: Dengpan Song | Species: mouse | Application: WB - Comparisons of the Effects of Low- or High-Fat Diets Rich in Soybean Oil, Lard, and Tea Seed Oil on Markers of Blood-Brain Barrier and Neuroinflammation in Ovariectomized Mice.
Journal: Int J Food Sci | Authors: Shyh-Hsiang Lin | Species: mouse | Application: WB - Comparison of the effects of Liraglutide, Tirzepatide, and Retatrutide on diabetic kidney disease in db/db mice
Journal: Endocrine | Authors: Jun Ma | Species: mouse | Application: IHC - ONO-2506 Can Delay Levodopa-induced Dyskinesia in the Early Stage
Journal: Neuroscience | Authors: Yuhao Yuan | Species: rat | Application: WB,IHC - Age-Associated Dopaminergic Neuron Loss and Midbrain Glia Cell Phenotypic Polarization.
Journal: Neuroscience | Authors: GuoQing Wang | Species: rat | Application: WB - Intranasal administration of Aloe-derived nanovesicles attenuates early radiation-induced lung injury.
Journal: Biochem Biophys Rep | Authors: Liangliang Zhang | Species: mouse | Application: IF - Neutralization of TLR2 in combination with either TNF-α or IL-1β antibody reduces the severity of septic arthritis through STAT3/mTOR signalling in lymphocytes
Journal: Cell Immunol | Authors: Rituparna Ghosh | Species: mouse | Application: WB - Age-Associated Dopaminergic Neuron Loss and Midbrain Glia Cell Phenotypic Polarization.
Journal: Neuroscience | Authors: GuoQing Wang | Species: rat | Application: WB - Caffeine inhibited the hyperoxia-induced A2AR-ERK/p38 MAPK-IL-8 pathway in type II alveolar epithelial cells to suppress NETs formation in bronchopulmonary dysplasia.
Journal: Pediatr Res | Authors: Xijuan Wang | Species: human | Application: WB - Detection of the role of intestinal flora and tryptophan metabolism involved in antidepressant-like actions of crocetin based on a multi-omics approach
Journal: Psychopharmacology (Berl) | Authors: Susu Lin | Species: mouse | Application: IHC - Comparison of the effects of Liraglutide, Tirzepatide, and Retatrutide on diabetic kidney disease in db/db mice
Journal: Endocrine | Authors: Jun Ma | Species: mouse | Application: IHC - M1 Macrophage-Derived Exosome LncRNA PVT1 Promotes Inflammation and Pyroptosis of Vascular Smooth Muscle Cells in Abdominal Aortic Aneurysm by Inhibiting miR-186-5p and Regulating HMGB1
Journal: Cardiovasc Toxicol | Authors: Jinhui Zhang | Species: human | Application: WB - Transcriptional landscape of human neuroblastoma cells in response to SARS-CoV-2.
Journal: BMC Neurosci | Authors: Rui-Cheng Yang | Species: human | Application: WB - ONO-2506 Can Delay Levodopa-induced Dyskinesia in the Early Stage
Journal: Neuroscience | Authors: Yuhao Yuan | Species: rat | Application: WB,IHC - Comparison of the effects of Liraglutide, Tirzepatide, and Retatrutide on diabetic kidney disease in db/db mice
Journal: Endocrine | Authors: Jun Ma | Species: mouse | Application: IHC - Caffeine inhibited the hyperoxia-induced A2AR-ERK/p38 MAPK-IL-8 pathway in type II alveolar epithelial cells to suppress NETs formation in bronchopulmonary dysplasia.
Journal: Pediatr Res | Authors: Xijuan Wang | Species: human | Application: WB - Sestrin2 Restricts Endothelial-to-Mesenchymal Transition Induced by Lipolysaccharide via Autophagy
Journal: J Integr Neurosci | Authors: Rongrong Huang | Species: human | Application: WB - Glymphatic Dysfunction in Migraine Mice Model
Journal: Neuroscience | Authors: Wanbin Huang | Species: mouse | Application: WB - Ginkgetin Attenuates Dextran Sulfate Sodium-Induced Colitis by Inhibiting the Nuclear Factor Kappa B Pathway.
Journal: Chem Biol Drug Des | Authors: Xuejing Qiao | Species: mouse,human | Application: WB - Curcumin protects human umbilical vein endothelial cells against high oxidized low density lipoprotein-induced lipotoxicity and modulates autophagy.
Journal: Iran J Basic Med Sci | Authors: Lifeng Zhao | Species: human | Application: WB - Investigating the role of itaconate in macrophage activation and oxidative stress injury in sepsis-associated acute kidney injury
Journal: Mol Biol Rep | Authors: Lei Yang | Species: mouse | Application: IHC - Baicalin Alleviates ADAM17/EGFR Axis-Induced Peritonitis in Weaned Piglets Infected by Glaesserella parasuis
Journal: Animals (Basel) | Authors: Qirong Lu | Application: WB - Protective effect of astaxanthin against La2O3 nanoparticles induced neurotoxicity by activating PI3K/AKT/Nrf-2 signaling in mice.
Journal: Food Chem Toxicol | Authors: Lu Yuan | Species: mouse | Application: WB - Role of nuclear factor of activated T Cells-1 in Sepsis-induced behavioral deficits in mice
Journal: Brain Res | Authors: Fan Jiang | Species: mouse | Application: WB - Deficiency of IKKα in Macrophages Mitigates Fibrosis Progression in the Kidney after Renal Ischemia-Reperfusion Injury.
Journal: J Immunol Res | Authors: Feng Zhang | Species: mouse | Application: WB - Forsythiaside A Alleviates LPS-Induced Mastitis by Inhibiting Ferroptosis and Oxidative Stress.
Journal: Animals (Basel) | Authors: Zhonghua Hao - Polystyrene microplastics facilitate renal fibrosis through accelerating tubular epithelial cell senescence
Journal: Food Chem Toxicol | Authors: Chun Pan | Species: mouse,human | Application: WB,IHC,IF - ZnO nanoparticles induce melanoma-like lesions via recruiting dermal dendritic cells in barrier-damaged skin in mice
Journal: Food Chem Toxicol | Authors: Menghan You | Species: mouse | Application: IHC - Curcumin protects human umbilical vein endothelial cells against high oxidized low density lipoprotein-induced lipotoxicity and modulates autophagy.
Journal: Iran J Basic Med Sci | Authors: Lifeng Zhao | Species: human | Application: WB - The Role of Luteolin in Inhibiting Prostaglandin-Endoperoxide Synthase 2 to Relieve Neointimal Hyperplasia in Arteriovenous Fistula
Journal: Adv Biol (Weinh) | Authors: Ruibin Zhang | Species: rat | Application: WB - Deficiency of IKKα in Macrophages Mitigates Fibrosis Progression in the Kidney after Renal Ischemia-Reperfusion Injury.
Journal: J Immunol Res | Authors: Feng Zhang | Species: mouse | Application: WB - Protective effect of astaxanthin against La2O3 nanoparticles induced neurotoxicity by activating PI3K/AKT/Nrf-2 signaling in mice.
Journal: Food Chem Toxicol | Authors: Lu Yuan | Species: mouse | Application: WB - Nicotine Induced Murine Spermatozoa Apoptosis via Up-Regulation of Deubiquitinated RIP1 by Trim27 Promoter Hypomethylation.
Journal: Biol Reprod | Authors: Dongsheng Nie | Species: mouse | Application: WB - Protective effect of astaxanthin against SnS2 nanoflowers induced testes toxicity by suppressing RIPK1-RIPK3-MLKL signaling in mice.
Journal: Food Chem Toxicol | Authors: Lu Yuan | Species: mouse | Application: WB - ZnO nanoparticles induce melanoma-like lesions via recruiting dermal dendritic cells in barrier-damaged skin in mice
Journal: Food Chem Toxicol | Authors: Menghan You | Species: mouse | Application: IHC - Crocetin confers neuroprotection and is anti-inflammatory in rats with induced glaucoma
Journal: Mol Biol Rep | Authors: Qiaoqiao Li | Species: rat | Application: IHC - The senescent marker p16INK4a enhances macrophage foam cells formation
Journal: Mol Biol Rep | Authors: Wei Sheng Siew | Species: human | Application: WB - Polystyrene microplastics facilitate renal fibrosis through accelerating tubular epithelial cell senescence
Journal: Food Chem Toxicol | Authors: Chun Pan | Species: mouse,human | Application: WB,IHC,IF - Nicotine Induced Murine Spermatozoa Apoptosis via Up-Regulation of Deubiquitinated RIP1 by Trim27 Promoter Hypomethylation.
Journal: Biol Reprod | Authors: Dongsheng Nie | Species: mouse | Application: WB - Baicalin Alleviates ADAM17/EGFR Axis-Induced Peritonitis in Weaned Piglets Infected by Glaesserella parasuis
Journal: Animals (Basel) | Authors: Qirong Lu | Application: WB - Subchronic arsenic exposure induced intestinal microbiota dysbiosis and intestinal inflammation via activating the NF-κB signaling pathway.
Journal: Food Chem Toxicol | Authors: Siyan Cao | Species: mouse | Application: WB - Forsythiaside A Alleviates LPS-Induced Mastitis by Inhibiting Ferroptosis and Oxidative Stress.
Journal: Animals (Basel) | Authors: Zhonghua Hao - Protective effects of ginsenoside Rk3 against chronic alcohol-induced liver injury in mice through inhibition of inflammation, oxidative stress, and apoptosis.
Journal: Food Chem Toxicol | Authors: Linlin Qu | Species: mouse | Application: WB - Shunaoxin pills improve the antihypertensive effect of nifedipine and alleviate its renal lipotoxicity in spontaneous hypertension rats.
Journal: Environ Toxicol | Authors: Xuanshuo Liu | Species: rat | Application: WB - 2-undecanone protects against fine particles-induced heart inflammation via modulating Nrf2/HO-1 and NF-κB pathways.
Journal: Environ Toxicol | Authors: Yuhang Jiao | Species: rat,mouse | Application: WB - The effect and mechanism of excessive iodine on the endothelial function of human umbilical vein endothelial cells
Journal: Environ Toxicol | Authors: Dandan Wang | Species: human - Glucose variability aggravates cardiac fibrosis by altering AKT signalling path.
Journal: Diab Vasc Dis Res | Authors: Changjiang Ying | Species: rat | Application: WB - Glucose variability aggravates cardiac fibrosis by altering AKT signalling path.
Journal: Diab Vasc Dis Res | Authors: Changjiang Ying | Species: rat | Application: WB - Rapamycin inhibits corneal inflammatory response and neovascularization in a mouse model of corneal alkali burn
Journal: Exp Eye Res | Authors: Jiande Li | Species: mouse | Application: WB - Three-dimensional cell culture in vitro could better recapitulate the biological behavior of cells in vivo.
Journal: Tissue Cell | Authors: Zhihao Qi | Species: human | Application: WB - Identify of blood glucose metabolism regulation pathways and related proteins in the db/db mouse model through iTRAQ quantitative mass spectrometry
Journal: Acta Diabetol | Authors: Yilin Yue | Species: mouse | Application: IHC - MST1 modulates inflammation by inhibiting BNIP3 -dependent mitophagy via the JNK/p53 pathway in acute lung injury.
Journal: Tissue Cell | Authors: Linli Song | Species: mouse | Application: IHC - Type 2 diabetes aggravates periodontitis-induced pathological changes in the dental pulp
Journal: Oral Dis | Authors: Tao Yang | Species: human | Application: WB - Identify of blood glucose metabolism regulation pathways and related proteins in the db/db mouse model through iTRAQ quantitative mass spectrometry
Journal: Acta Diabetol | Authors: Yilin Yue | Species: mouse | Application: IHC - Proanthocyanidins inhibit the inflammation response of dry eye by regulating IRAK4/JAK1/STAT1 signaling pathway.
Journal: Exp Eye Res | Authors: Ying Lian | Species: mouse | Application: IF - Glucose variability aggravates cardiac fibrosis by altering AKT signalling path.
Journal: Diab Vasc Dis Res | Authors: Changjiang Ying | Species: rat | Application: WB - PTP1B promotes macrophage activation by regulating the NF-κB pathway in alcoholic liver injury.
Journal: Toxicol Lett | Authors: Lei Yang | Species: mouse | Application: WB - Tartary Buckwheat protein-derived peptide AFYRW alleviates H₂O₂-induced inflammation and apoptosis in HaCaT cells by activating SIRT1-dependent deacetylation.
Journal: Tissue Cell | Authors: Hongmei Li - Donkey Oil-Based Ketogenic Diet Prevents Tumor Progression by Regulating Intratumor Inflammation, Metastasis and Angiogenesis in CT26 Tumor-Bearing Mice
Journal: Genes (Basel) | Authors: Huachen Zhang | Species: mouse | Application: WB - STAT1-IFITM3 promotes autophagy in epithelial cells to control Cryptosporidium parvum infection
Journal: Life Sci Alliance | Authors: Lijun Cui | Species: human | Application: WB - Tear dynamics testing and quantitative proteomics analysis in patients with chronic renal failure.
Journal: J Proteomics | Authors: Rong-Rong Zong | Species: human | Application: WB - PTP1B promotes macrophage activation by regulating the NF-κB pathway in alcoholic liver injury.
Journal: Toxicol Lett | Authors: Lei Yang | Species: mouse | Application: WB - The effect of astaxanthin on inflammation in hyperosmolarity of experimental dry eye model in vitro and in vivo.
Journal: Exp Eye Res | Authors: Hui Li | Species: human | Application: WB - Tongfu Pingchuan decoction enhances Chrm4 expression in intestinal macrophages to alleviate sepsis in rats.
Journal: 3 Biotech | Authors: Limeng Yang - Proanthocyanidins inhibit the inflammation response of dry eye by regulating IRAK4/JAK1/STAT1 signaling pathway.
Journal: Exp Eye Res | Authors: Ying Lian | Species: mouse | Application: IF - STAT1-IFITM3 promotes autophagy in epithelial cells to control Cryptosporidium parvum infection
Journal: Life Sci Alliance | Authors: Lijun Cui | Species: human | Application: WB - Type 2 diabetes aggravates periodontitis-induced pathological changes in the dental pulp
Journal: Oral Dis | Authors: Tao Yang | Species: human | Application: WB - Tongfu Pingchuan decoction enhances Chrm4 expression in intestinal macrophages to alleviate sepsis in rats.
Journal: 3 Biotech | Authors: Limeng Yang - Normothermic ex vivo heart perfusion with NLRP3 inflammasome inhibitor Mcc950 treatment improves cardiac function of circulatory death hearts after transplantation
Journal: Front Cardiovasc Med | Authors: Liwei Xu | Species: rat | Application: WB - Steroidogenic acute regulatory protein (StAR) overexpression reduces inflammation and insulin resistance in obese mice.
Journal: J Cell Biochem | Authors: Yanyan Qiu | Species: mouse | Application: WB - PRDX2 Protects Against Atherosclerosis by Regulating the Phenotype and Function of the Vascular Smooth Muscle Cell.
Journal: Front Cardiovasc Med | Authors: Jing Li | Species: human | Application: WB - Normothermic ex vivo heart perfusion with NLRP3 inflammasome inhibitor Mcc950 treatment improves cardiac function of circulatory death hearts after transplantation
Journal: Front Cardiovasc Med | Authors: Liwei Xu | Species: rat | Application: WB - Steroidogenic acute regulatory protein (StAR) overexpression reduces inflammation and insulin resistance in obese mice.
Journal: J Cell Biochem | Authors: Yanyan Qiu | Species: mouse | Application: WB - Traditional Chinese Medication Qiliqiangxin Attenuates Diabetic Cardiomyopathy via Activating PPARγ.
Journal: Front Cardiovasc Med | Authors: Xiaodong Wu | Species: rat - Lidocaine ameliorates intestinal barrier dysfunction in irritable bowel syndrome by modulating corticotropin-releasing hormone receptor 2
Journal: Neurogastroenterol Motil | Authors: Yanrong Wang | Species: rat | Application: IHC - miR-128 participates in the pathogenesis of chronic constipation by regulating the p38α/M-CSF inflammatory signaling pathway.
Journal: Am J Physiol Gastrointest Liver Physiol | Authors: Yuntian Hong | Species: mouse | Application: WB - PL-Relief™plus Alleviates Atopic Dermatitis and Regulates Inflammatory Responses via Inhibiting NF-κB Signaling Pathway
Journal: Chem Biodivers | Authors: Bing Zhao | Species: mouse | Application: IHC - Cocktail of three isoquinoline alkaloids derived from Glaucium grandiflorum Boiss. & A. Huet subsp. refractum (Nábelek) Mory inhibits the production of LPS-induced ROS, pro-inflammatory cytokines, and mediators through the down-regulation of p38 MAPK in BV-2 cells
Journal: Fitoterapia | Authors: Serap Nigdelioglu Dolanbay | Species: mouse | Application: WB - Inhibition of glutamine transporter ASCT2 mitigates bleomycin-induced pulmonary fibrosis in mice
Journal: Acta Histochem | Authors: Naqi Lian | Species: mouse | Application: WB - Dendrobium huoshanense Polysaccharide Improves High-Fat Diet Induced Liver Injury by Regulating the Gut-Liver Axis
Journal: Chem Biodivers | Authors: Meng-Hua Ma | Species: mouse | Application: IHC - Enhanced immunogenicity of the tuberculosis subunit Rv0572c vaccine delivered in DMT liposome adjuvant as a BCG-booster.
Journal: Tuberculosis (Edinb) | Authors: Lirong Mao | Species: mouse | Application: WB - Cynaroside prevents macrophage polarization into pro-inflammatory phenotype and alleviates cecal ligation and puncture-induced liver injury by targeting PKM2/HIF-1α axis.
Journal: Fitoterapia | Authors: Liuhua Pei | Species: mouse | Application: WB,IHC - PL-Relief™plus Alleviates Atopic Dermatitis and Regulates Inflammatory Responses via Inhibiting NF-κB Signaling Pathway
Journal: Chem Biodivers | Authors: Bing Zhao | Species: mouse | Application: IHC - Dendrobium huoshanense Polysaccharide Improves High-Fat Diet Induced Liver Injury by Regulating the Gut-Liver Axis
Journal: Chem Biodivers | Authors: Meng-Hua Ma | Species: mouse | Application: IHC - Modulation of immune cell differentiation by Prunella vulgaris L. essential oil in pulmonary sarcoidosis treatment.
Journal: Fitoterapia | Authors: Zhiguo Mao | Species: mouse | Application: WB - Cocktail of three isoquinoline alkaloids derived from Glaucium grandiflorum Boiss. & A. Huet subsp. refractum (Nábelek) Mory inhibits the production of LPS-induced ROS, pro-inflammatory cytokines, and mediators through the down-regulation of p38 MAPK in BV-2 cells
Journal: Fitoterapia | Authors: Serap Nigdelioglu Dolanbay | Species: mouse | Application: WB - Investigation of the underlying mechanism of Buyang Huanwu decoction in ischemic stroke by integrating systems pharmacology-proteomics and in vivo experiments
Journal: Fitoterapia | Authors: Weiguo Liao | Species: rat | Application: WB - Exploring the effects of hypoxia and reoxygenation time on hepatocyte apoptosis and inflammation
Journal: PLoS One | Authors: Xinlu Xu | Species: human | Application: WB - NF-E2-Related Factor 2 Suppresses Intestinal Fibrosis by Inhibiting Reactive Oxygen Species-Dependent TGF-β1/SMADs Pathway.
Journal: Dig Dis Sci | Authors: Yadi Guan | Species: mouse | Application: WB - Role of Esketamine in Attenuating Neuroinflammation and Improving Postoperative Cognitive Function via Autophagy Activation Through PARP1 Targeting.
Journal: Physiol Res | Authors: Chendi ZHAO | Species: mouse | Application: WB - Supplementation with dietary omega-3 PUFA mitigates fetal brain inflammation and mitochondrial damage caused by high doses of sodium nitrite in maternal rats.
Journal: PLoS One | Authors: Jingchi Sun | Species: rat | Application: WB - Porphyromonas gingivalis Lipopolysaccharide Damages Mucosal Barrier to Promote Gastritis-Associated Carcinogenesis
Journal: Dig Dis Sci | Authors: Masayoshi Oriuchi | Species: mouse,human | Application: WB - Palmitate lipotoxicity is closely associated with the fatty acid-albumin complexes in BV-2 microglia
Journal: PLoS One | Authors: Yanzhuo Yang | Species: mouse | Application: WB - Maternal immune activation alters adult behavior, intestinal integrity, gut microbiota and the gut inflammation.
Journal: Brain Behav | Authors: Wenqiang Li | Species: human | Application: WB - Upregulation of Metrnl improves diabetic kidney disease by inhibiting the TGF-β1/Smads signaling pathway: A potential therapeutic target
Journal: PLoS One | Authors: Lu Lin | Species: mouse | Application: WB,IHC - Irisin ameliorates UUO-induced renal interstitial fibrosis through TGF-β1/periostin/MMP-2 signaling pathway
Journal: PLoS One | Authors: Yashu Wang | Species: human | Application: WB,IF - Acyloxyacyl hydrolase regulates microglia-mediated pelvic pain
Journal: PLoS One | Authors: Afrida Rahman-Enyart | Species: mouse | Application: WB - Dysregulated B7H4/JAK2/STAT3 Pathway Involves in Hypertriglyceridemia Acute Pancreatitis and Is Attenuated by Baicalin.
Journal: Dig Dis Sci | Authors: Jie Yang | Species: mouse | Application: WB,IHC - Palmitate lipotoxicity is closely associated with the fatty acid-albumin complexes in BV-2 microglia
Journal: PLoS One | Authors: Yanzhuo Yang | Species: mouse | Application: WB - Sevoflurane Protects against Intestinal Ischemia-Reperfusion Injury by Activating Peroxisome Proliferator-Activated Receptor Gamma/Nuclear Factor-κB Pathway in Rats.
Journal: Pharmacology | Authors: Chuiliang Liu | Species: rat | Application: WB - Single Cell Proteomics Profiling Reveals That Embryo-Secreted TNF-α Plays a Critical Role During Embryo Implantation to the Endometrium.
Journal: Reprod Sci | Authors: Jiao Lv | Species: human | Application: IF - ETC-1002 Attenuates Porphyromonas gingivalis Lipopolysaccharide-Induced Inflammation in RAW264.7 Cells via the AMPK/NF-κB Pathway and Exerts Ameliorative Effects in Experimental Periodontitis in Mice.
Journal: Dis Markers | Authors: Hongyan Li | Species: mouse | Application: WB - Epithelial-specific deletion of FAM20A leads to Short Root Defects
Journal: Gene | Authors: Lixue Liu | Species: mouse | Application: WB - SOGA1 drives ovarian cancer progression via regulation of GNAI1 and activation of the TNF/NF-κB pathway
Journal: Gene | Authors: Tengfei Long | Application: WB - Renoprotective effects of levosimendan on acute kidney injury following cardiac arrest via anti-inflammation, anti-apoptosis and ERK activation.
Journal: FEBS Open Bio | Authors: Lei Tian | Species: rat - 5-HT3a Receptor Contributes to Neuropathic Pain by Regulating Central Sensitization in a Rat with Brachial Plexus Avulsion
Journal: Physiol Behav | Authors: Chengpeng Liao | Species: rat | Application: WB - A COMPARATIVE ANALYSIS TO DETERMINE THE OPTIMUM HISTONE DEACETYLASE INHIBITORS AND ADMINISTRATION ROUTE FOR IMPROVING SURVIVAL AND ORGAN INJURY IN RATS AFTER HEMORRHAGIC SHOCK
Journal: Shock | Authors: Kunwei Niu | Species: rat | Application: WB - Exosomal tpi-miR-10a-5p from T. pisiformis cysticerci regulates the expression of inflammatory factors in rabbits by targeting MAP3K7
Journal: Vet Parasitol | Authors: Guiting Pu | Species: rabbit | Application: WB - Renoprotective effects of levosimendan on acute kidney injury following cardiac arrest via anti-inflammation, anti-apoptosis and ERK activation.
Journal: FEBS Open Bio | Authors: Lei Tian | Species: rat - A COMPARATIVE ANALYSIS TO DETERMINE THE OPTIMUM HISTONE DEACETYLASE INHIBITORS AND ADMINISTRATION ROUTE FOR IMPROVING SURVIVAL AND ORGAN INJURY IN RATS AFTER HEMORRHAGIC SHOCK
Journal: Shock | Authors: Kunwei Niu | Species: rat | Application: WB - Effects of a Macroporous Resin Extract of Dendrobium officinale Leaves in Rats with Hyperuricemia Induced by Anthropomorphic Unhealthy Lifestyle
Journal: Evid Based Complement Alternat Med | Authors: Lin-Zi Li | Species: rat | Application: IHC - LACC1 Enhances Polyamine Immunometabolism in Inflammatory Macrophages to Inhibit Atherosclerosis Progression
Journal: J Cardiovasc Transl Res | Authors: Jingyong Zhang | Species: mouse | Application: WB - Hirudin Attenuates Uric Acid-Induced Renal Tubular Injury via TNFRSF6B-Mediated Suppression of NF-κB Signaling.
Journal: Pharmacol Res Perspect | Authors: Yingxue Zhao - Deficiency of monoclonal non-specific suppressor factor beta (MNSFB) promotes pregnancy loss in mice.
Journal: Mol Reprod Dev | Authors: Yan Gu | Species: mouse | Application: WB - LACC1 Enhances Polyamine Immunometabolism in Inflammatory Macrophages to Inhibit Atherosclerosis Progression
Journal: J Cardiovasc Transl Res | Authors: Jingyong Zhang | Species: mouse | Application: WB - Hirudin Attenuates Uric Acid-Induced Renal Tubular Injury via TNFRSF6B-Mediated Suppression of NF-κB Signaling.
Journal: Pharmacol Res Perspect | Authors: Yingxue Zhao - Exploring the mechanisms of baicalin in diabetic cardiomyopathy: Insights from network pharmacology and experimental validation.
Journal: Biomed Rep | Authors: Xuyong Zhao - Administration of Alistipes indistinctus prevented the progression from nonalcoholic fatty liver disease to nonalcoholic steatohepatitis by enhancing the gut barrier and increasing Lactobacillus spp
Journal: Biochem Biophys Res Commun | Authors: Xiaoxue Xu | Species: mouse | Application: WB - Mechanism of ligusticum cycloprolactam against neuroinflammation based on network pharmacology and experimental verification
Journal: Clin Exp Pharmacol Physiol | Authors: Juan Gao | Species: human | Application: WB - Dihydroartemisinin restrains angiogenesis through the TNF-α pathway to enhance the efficacy of anti-PD-1 immunotherapy in breast cancer
Journal: Biochem Biophys Res Commun | Authors: Meng Zou | Species: mouse | Application: WB - Acupuncture exerts preventive effects in rats of chronic unpredictable mild stress: The involvement of inflammation in amygdala and brain-spleen axis
Journal: Biochem Biophys Res Commun | Authors: Wenjie Chen | Species: rat | Application: WB - Long-term efavirenz exposure induced neuroinflammation and cognitive deficits in C57BL/6 mice.
Journal: Biochem Biophys Res Commun | Authors: Runji Zhang | Species: mouse | Application: WB - Inhibition of mGluR5 ameliorates lipid accumulation and inflammation in HepG2 cells
Journal: Biochem Biophys Res Commun | Authors: Shu Zeng | Species: human | Application: WB - Administration of Alistipes indistinctus prevented the progression from nonalcoholic fatty liver disease to nonalcoholic steatohepatitis by enhancing the gut barrier and increasing Lactobacillus spp
Journal: Biochem Biophys Res Commun | Authors: Xiaoxue Xu | Species: mouse | Application: WB - Potential effect and mechanism of ultrashort wave therapy in mice with chronic rhinosinusitis.
Journal: Biomed Rep | Authors: HUIFANG XU | Species: mouse | Application: IF - Purinergic P2X7 receptor involves in anti-retinal photodamage effects of berberine
Journal: Purinergic Signal | Authors: Shan-Shan Ye | Species: mouse | Application: WB - Resveratrol attenuates radiation enteritis through the SIRT1/FOXO3a and PI3K/AKT signaling pathways.
Journal: Biochem Biophys Res Commun | Authors: Haoren Qin | Species: human | Application: WB - Dihydroartemisinin restrains angiogenesis through the TNF-α pathway to enhance the efficacy of anti-PD-1 immunotherapy in breast cancer
Journal: Biochem Biophys Res Commun | Authors: Meng Zou | Species: mouse | Application: WB - Cartilage Damage Pathological Characteristics of Diabetic Neuropathic Osteoarthropathy
Journal: Anal Cell Pathol (Amst) | Authors: Pei-Long Liu | Species: human | Application: WB - Hydrogen sulfide improves keratinocytes migration and diabetic skin wound healing via plakophilin 4.
Journal: Biochem Biophys Res Commun | Authors: Bishan Zhang | Species: mouse | Application: IHC - An immunocytokine consisting of a TNFR2 agonist and TNFR2 scFv enhances the expansion of regulatory T cells through TNFR2 clustering
Journal: Biochem Biophys Res Commun | Authors: Masaki Inoue - Cartilage Damage Pathological Characteristics of Diabetic Neuropathic Osteoarthropathy
Journal: Anal Cell Pathol (Amst) | Authors: Pei-Long Liu | Species: human | Application: WB - Hydrogen sulfide improves keratinocytes migration and diabetic skin wound healing via plakophilin 4.
Journal: Biochem Biophys Res Commun | Authors: Bishan Zhang | Species: mouse | Application: IHC - Potential effect and mechanism of ultrashort wave therapy in mice with chronic rhinosinusitis.
Journal: Biomed Rep | Authors: HUIFANG XU | Species: mouse | Application: IF - An immunocytokine consisting of a TNFR2 agonist and TNFR2 scFv enhances the expansion of regulatory T cells through TNFR2 clustering
Journal: Biochem Biophys Res Commun | Authors: Masaki Inoue - Rehmannioside A alleviates renal inflammation and fibrosis in hypertensive nephropathy via AT1R/MAPK14/IL-17 signaling pathway
Journal: Biochem Biophys Res Commun | Authors: Furong Liu | Species: mouse | Application: WB - Resveratrol attenuates radiation enteritis through the SIRT1/FOXO3a and PI3K/AKT signaling pathways.
Journal: Biochem Biophys Res Commun | Authors: Haoren Qin | Species: human | Application: WB - Rehmannioside A alleviates renal inflammation and fibrosis in hypertensive nephropathy via AT1R/MAPK14/IL-17 signaling pathway
Journal: Biochem Biophys Res Commun | Authors: Furong Liu | Species: mouse | Application: WB - In vitro and in vivo effects of hyperglycemia and diabetes mellitus on nucleus pulposus cell senescence.
Journal: J Orthop Res | Authors: Zengxin Jiang | Species: human | Application: IHC - Intranasal LAG3 antibody infusion induces microglia-dependent antidepressant effect by mobilizing astrocytic P2Y1R-mediated BDNF synthesis in the hippocampus.
Journal: Pharmacol Biochem Behav | Authors: Wenfeng Hu | Species: mouse | Application: ELISA - Rice protein suppresses 4-hydroxy-2-nonenal-induced inflammation owing to methionine availability.
Journal: Appl Physiol Nutr Metab | Authors: Zhengxuan Wang | Species: rat | Application: WB - Hawthorn polyphenols reduce high glucose-induced inflammation and apoptosis in ARPE-19 cells by regulating miR-34a/SIRT1 to reduce acetylation.
Journal: J Food Biochem | Authors: Suwen Liu | Species: human | Application: WB - Rufinamide (RUF) suppresses inflammation and maintains the integrity of the blood-brain barrier during kainic acid-induced brain damage.
Journal: Open Life Sci | Authors: Huaxu Yu | Species: mouse | Application: WB - Rufinamide (RUF) suppresses inflammation and maintains the integrity of the blood-brain barrier during kainic acid-induced brain damage.
Journal: Open Life Sci | Authors: Huaxu Yu | Species: mouse | Application: WB - Corn oligopeptides inhibit Akt/NF-κB signaling pathway and inflammatory factors to ameliorate CCl4 -induced hepatic fibrosis in mice.
Journal: J Food Biochem | Authors: Xiao-Wen Feng | Species: mouse | Application: WB - Holothuria Leucospilota polysaccharides alleviate hyperlipidemia via alteration of lipid metabolism and inflammation-related gene expression
Journal: J Food Biochem | Authors: Shanshan Lu | Species: rat | Application: WB - Upregulation of TACAN in the trigeminal ganglion affects pain transduction in acute pulpitis
Journal: Arch Oral Biol | Authors: Yicong Shang | Species: rat | Application: IHC - The Effect of miR-520b on Macrophage Polarization and T Cell Immunity by Targeting PTEN in Breast Cancer.
Journal: J Oncol | Authors: Qin Zhu | Species: human | Application: WB - Metformin attenuated sepsis-associated liver injury and inflammatory response in aged mice.
Journal: Bioengineered | Authors: Heng Song | Species: mouse | Application: WB - Metformin attenuated sepsis-associated liver injury and inflammatory response in aged mice.
Journal: Bioengineered | Authors: Heng Song | Species: mouse | Application: WB - Oxycodone protects cardiac microvascular endothelial cells against ischemia/reperfusion injury by binding to Sigma-1 Receptor.
Journal: Bioengineered | Authors: Meihua Ji | Species: rat | Application: WB - Ferrostatin-1 alleviates lipopolysaccharide-induced cardiac dysfunction.
Journal: Bioengineered | Authors: Zheng Xiao | Species: rat | Application: WB - Swimming training combined with fecal microbial transplantation protects motor functions in rats with spinal cord injury by improving the intestinal system
Journal: Neurosci Lett | Authors: Shuai Ouyang | Species: rat | Application: WB - Apelin-13 reduces lipopolysaccharide-induced neuroinflammation and cognitive impairment via promoting glucocorticoid receptor expression and nuclear translocation
Journal: Neurosci Lett | Authors: Sheng Hu | Species: rat | Application: WB - Effects of intrahepatic cholestasis of pregnancy on hepatic function, changes of inflammatory cytokines and fetal outcomes.
Journal: Exp Ther Med | Authors: Liping Wang | Species: human - Pyrroloquinoline quinone protects against murine hepatitis virus strain 3-induced fulminant hepatitis by inhibiting the Keap1/Nrf2 signaling
Journal: Cytotechnology | Authors: Zunguo Pu | Species: mouse | Application: WB - Apelin-13 reduces lipopolysaccharide-induced neuroinflammation and cognitive impairment via promoting glucocorticoid receptor expression and nuclear translocation
Journal: Neurosci Lett | Authors: Sheng Hu | Species: rat | Application: WB - Effects of ubiquitin-proteasome inhibitor on the expression levels of TNF-α and TGF-β1 in mice with viral myocarditis.
Journal: Exp Ther Med | Authors: Hui Zhang | Species: mouse | Application: WB - Swimming training combined with fecal microbial transplantation protects motor functions in rats with spinal cord injury by improving the intestinal system
Journal: Neurosci Lett | Authors: Shuai Ouyang | Species: rat | Application: WB - Influence of vitamin D deficiency on T cell subsets and related indices during spinal tuberculosis.
Journal: Exp Ther Med | Authors: Shao-Huai Zhou | Species: human | Application: IHC - Maiwei Yangfei decoction prevents bleomycin-induced pulmonary fibrosis in mice.
Journal: Exp Ther Med | Authors: Yong Xu | Species: mouse | Application: WB - Influence of vitamin D deficiency on T cell subsets and related indices during spinal tuberculosis.
Journal: Exp Ther Med | Authors: Shao-Huai Zhou | Species: human | Application: IHC - Intervention effect of small extracellular vesicles derived from dental pulp stem cells on a high-altitude pulmonary edema model in male rats.
Journal: Physiol Rep | Authors: Xue Li | Species: rat | Application: IF - The multifaceted modulations by dapagliflozin in preventing hyperglycemia-induced diabetic nephropathy through glucose transporters and PPARα
Journal: J Diabetes Metab Disord | Authors: Hsien-Hui Chung | Species: rat | Application: WB - Curcumin inhibits the growth of liver cancer by impairing myeloid-derived suppressor cells in murine tumor tissues.
Journal: Oncol Lett | Authors: Sha Tian | Species: mouse | Application: WB - The P38MAPK/ATF2 signaling pathway is involved in PND in mice
Journal: Exp Brain Res | Authors: Mengjiao Zhu | Species: mouse | Application: WB - L-Methionine inhibits 4-hydroxy-2-nonenal accumulation and suppresses inflammation in growing rats
Journal: Nutr Res Pract | Authors: Zhengxuan Wang | Species: rat | Application: WB - Intervention effect of small extracellular vesicles derived from dental pulp stem cells on a high-altitude pulmonary edema model in male rats.
Journal: Physiol Rep | Authors: Xue Li | Species: rat | Application: IF - SanHuang decoction may suppress breast cancer by regulating M1 macrophage polarization via NF-κB signaling pathway: in vitro and in vivo studies.
Journal: Transl Cancer Res | Authors: Yu Ying | Species: human | Application: WB - Relationship between irradiation-induced neuro-inflammatory environments and impaired cognitive function in the developing brain of mice.
Journal: Int J Radiat Biol | Authors: XiaoRong Dong | Species: mouse | Application: IHC - Schisandrin ameliorates cognitive deficits, endoplasmic reticulum stress and neuroinflammation in STZ-induced Alzheimer's disease rats.
Journal: Exp Anim | Authors: Lin Song | Species: rat | Application: WB - Decreased autophagic activity of detrusor cells is involved in the inflammatory response of interstitial cystitis/bladder pain syndrome.
Journal: Int Urogynecol J | Authors: Jiang Zhao | Species: human | Application: WB,IHC - The chitosan collagen salvianolic membrane mitigates intervertebral disc degeneration through suppression of the Wnt/β-catenin signaling.
Journal: In Vitro Cell Dev Biol Anim | Authors: Zhaozhong Yu | Species: rabbit | Application: WB - Neu5Ac promotes high-fat diet-induced progression of atherosclerosis in Apoe-deficient mice.
Journal: Exp Anim | Authors: Dong Huang | Species: mouse | Application: WB - Schisandrin ameliorates cognitive deficits, endoplasmic reticulum stress and neuroinflammation in STZ-induced Alzheimer's disease rats.
Journal: Exp Anim | Authors: Lin Song | Species: rat | Application: WB - Boxb mediate BALB/c mice corneal inflammation through a TLR4/MyD88-dependent signaling pathway in Aspergillus fumigatus keratitis.
Journal: Int J Ophthalmol | Authors: Min Liu | Species: mouse | Application: WB - Anti-inflammatory effect of combined tetramethylpyrazine, resveratrol and curcumin in vivo.
Journal: BMC Complement Altern Med | Authors: Long Chen | Species: mouse | Application: IHC - Gastroprotective Activity of the Total Flavones from Abelmoschus manihot (L.) Medic Flowers.
Journal: Evid Based Complement Alternat Med | Authors: Jun Zhang | Species: mouse | Application: WB - Chicoric acid attenuates hyperglycemia-induced endothelial dysfunction through AMPK-dependent inhibition of oxidative/nitrative stresses.
Journal: J Recept Signal Transduct Res | Authors: Xiaojuan Ma | Species: human | Application: WB - Electroacupuncture alleviates Parkinson's disease-related pain by inhibiting microglial NLRP3-ASC inflammasome in the amygdala.
Journal: Braz J Med Biol Res | Authors: Xiao-Wei Wang - Danshensu methyl ester attenuated LPS-induced acute lung injury by inhibiting TLR4/NF-κB pathway
Journal: Respir Physiol Neurobiol | Authors: Xuejia Han | Species: mouse | Application: WB - OPN Promotes Cell Proliferation and Invasion through NF-κB in Human Esophageal Squamous Cell Carcinoma
Journal: Genet Res (Camb) | Authors: Bolin Chen | Species: human | Application: WB - Evaluation of transurethral GreenLight laser-selective vaporization for refractory overactive bladder in women
Journal: Transl Androl Urol | Authors: Kun Du | Species: human | Application: IHC - Effects of Bacillus subtilis on Epithelial Tight Junctions of Mice with Inflammatory Bowel Disease.
Journal: J Interferon Cytokine Res | Authors: Yi Gong | Species: mouse | Application: WB - LXW7 ameliorates focal cerebral ischemia injury and attenuates inflammatory responses in activated microglia in rats.
Journal: Braz J Med Biol Res | Authors: T Fang | Species: rat | Application: WB - Luteolin Improves Cyclophosphamide-Induced Cystitis through TXNIP/NLRP3 and NF-κB Pathways.
Journal: Evid Based Complement Alternat Med | Authors: Hengshuai Zhang | Species: rat | Application: WB - Effect of Moxibustion on the Intestinal Flora of Rats with Knee Osteoarthritis Induced by Monosodium Iodoacetate.
Journal: Evid Based Complement Alternat Med | Authors: Yu Chen | Species: rat | Application: WB - Baicalin Attenuates Continuous Activation of β-Catenin Induced by Lipopolysaccharide (LPS) and Depression Complicated by Infertility in Male Rats.
Journal: Evid Based Complement Alternat Med | Authors: Rong Fan | Species: rat | Application: WB - Microarray analysis reveals a potential role of lncRNA expression in remote ischemic preconditioning in myocardial ischemia-reperfusion injury.
Journal: Am J Transl Res | Authors: Zhiling Lou | Species: mouse | Application: WB - TGF-β-Smad2/3 signaling in high-altitude pulmonary hypertension in rats: Role and mechanisms via macrophage M2 polarization
Journal: Open Med (Wars) | Authors: Wende Ma - The cardioprotective effect of the sodium-glucose cotransporter 2 inhibitor dapagliflozin in rats with isoproterenol-induced cardiomyopathy.
Journal: Am J Transl Res | Authors: Fang-Zheng Wang | Species: rat | Application: WB - The cardioprotective effect of the sodium-glucose cotransporter 2 inhibitor dapagliflozin in rats with isoproterenol-induced cardiomyopathy.
Journal: Am J Transl Res | Authors: Fang-Zheng Wang | Species: rat | Application: WB - Microarray analysis reveals a potential role of lncRNA expression in remote ischemic preconditioning in myocardial ischemia-reperfusion injury.
Journal: Am J Transl Res | Authors: Zhiling Lou | Species: mouse | Application: WB - PTBP-1 and TNF-α/NF-κB are involved in repair mechanisms of human umbilical cord mesenchymal stem cell transplantation in mice with spinal cord injury
Journal: Am J Transl Res | Authors: Hua Cao | Species: mouse | Application: WB - Taurine inhibits necroptosis helps to alleviate inflammatory and injury induced by Klebsiella infection.
Journal: Vet Immunol Immunopathol | Authors: Huifang Yin | Species: mouse | Application: WB - Danggui Buxue Decoction Combined with Borneol Improves Cyclophosphamide-Induced Myelosuppression by Inhibiting CDK2
Journal: Cancer Biother Radiopharm | Authors: Kui Li | Application: WB - Exploring the Action Mechanism and Validation of the Key Pathways of Dendrobium officinale Throat-clearing Formula for the Treatment of Chronic Pharyngitis Based on Network Pharmacology
Journal: Comb Chem High Throughput Screen | Authors: Xi Fang | Species: rat | Application: IHC - Protective effect of HDACIs in improves survival and organ injury after CLP-induced sepsis
Journal: Surg Open Sci | Authors: Kunwei Niu | Species: rat | Application: WB - Antichronic Gastric Ulcer Effect of Zinc-Baicalin Complex on the Acetic Acid-Induced Chronic Gastric Ulcer Rat Model.
Journal: Gastroenterol Res Pract | Authors: Hui Yang | Species: rat | Application: WB - Underexpression of Receptor for Activated C Kinase 1 (RACK1) in Leukocytes from Patients with Severe Acute Pancreatitis.
Journal: Tohoku J Exp Med | Authors: Xiaoxin Zhang | Species: rat | Application: WB - Targeting CCNB1 Repressed Cartilage Degradation Induced by Inflammation Through NF-κB Pathway in Osteoarthritis.
Journal: J Histochem Cytochem | Authors: Hua Li | Species: mouse | Application: WB - Resveratrol Attenuates Neuroinflammation and Myelination Deficits in Repeated Sevoflurane-Exposed Neonatal Mice.
Journal: Int J Dev Neurosci | Authors: Ji Che | Species: mouse | Application: WB - Vitamin D3 alleviates intestinal injury in necrotizing enterocolitis and lipopolysaccharide-induced inflammatory response in dendritic cells in rats
Journal: Turk J Med Sci | Authors: Bo Ke | Species: rat,mouse | Application: IF - H2S improves doxorubicin-induced myocardial fibrosis by inhibiting oxidative stress and apoptosis via Keap1-Nrf2.
Journal: Technol Health Care | Authors: Yaling Li | Species: rat | Application: WB - MiR-181c-5p ameliorates learning and memory in sleep-deprived mice via HMGB1/TLR4/NF-κB pathway
Journal: An Acad Bras Cienc | Authors: Yujie Hu | Species: mouse | Application: WB - The protective mechanism of folic acid on hyperhomocysteinemia-related arterial injury in spontaneously hypertensive rats: Folic acid against arterial inflammation.
Journal: Vascular | Authors: Lihua Zhang | Species: rat | Application: WB - A classic prescription alleviates inflammation in CUMS model mice via modulating MYDGF/MAP4K4/NF-κB signaling pathway, verified through UPLC-HRMS and proteomics analysis
Journal: Heliyon | Authors: Ruolan Huang | Species: Mouse | Application: WB - Curcumin enhances elvitegravir concentration and alleviates oxidative stress and inflammatory response
Journal: Res Sq | Authors: Sandip Godse | Species: mouse | Application: WB - Aging increases the susceptibility of cisplatin-induced nephrotoxicity.
Journal: Age (Dordr) | Authors: Jiagen Wen | Species: mouse | Application: WB - [Jia Wei Qingxin Lotus Seed Drink improves diabetic kidney disease in mice by regulating the KDM3C/SP1 signaling pathway].
Journal: Nan Fang Yi Ke Da Xue Xue Bao | Authors: XIE Jiarun | Species: mouse | Application: WB - Epigallocatechin-3-gallate protects sepsis-induced myocardial dysfunction by inhibiting the nuclear factor-κB signaling pathway
Journal: Heliyon | Authors: Bei Chen | Species: rat | Application: WB - A classic prescription alleviates inflammation in CUMS model mice via modulating MYDGF/MAP4K4/NF-κB signaling pathway, verified through UPLC-HRMS and proteomics analysis
Journal: Heliyon | Authors: Ruolan Huang | Species: Mouse | Application: WB - Comparison of CUMS at different pregnancy stages, maternal separation, and their effects on offspring in postpartum depression mouse models
Journal: Heliyon | Authors: Fei Fei | Species: mouse | Application: IHC - Ectopic engraftment of nociceptive neurons derived from hPSCs for pain relief and joint homeostasis.
Journal: bioRxiv | Authors: Zhuolun Wang | Species: mouse | Application: IF - The lncRNA GAS5 upregulates ANXA2 to mediate the macrophage inflammatory response during atherosclerosis development
Journal: Heliyon | Authors: Yuzhou Xue | Species: mouse | Application: WB - [Aqueous extract of Chuan Xiong Rhizoma enhances inhibitory effect of temozolomide against brain metastasis of melanoma in mice]
Journal: Nan Fang Yi Ke Da Xue Xue Bao | Authors: Q Zhao | Species: mouse | Application: IF - Wenshenqianlie capsule improves benign prostatic hyperplasia via its anti-inflammatory and antioxidant effects
Journal: Aging (Albany NY) | Authors: Rui Liu | Species: mouse | Application: WB - Astrocytic FABP5 drives non-cell-autonomous oligodendrocyte injury in multiple system atrophy by promoting TNF signaling and ferroptotic stress.
Journal: Redox Biol | Authors: Chuantao Wu - Estrogen relieved chronic pain-triggered cognitive dysfunction via restraining excessive inhibition in PV interneurons related to neuroinflammation.
Journal: Neurochem Int | Authors: Xiaoxiang Tan - Periodontitis aggravates high-fat diet-induced MASLD via gut microbiota dysbiosis and metabolic dysfunction in mice.
Journal: Sci Rep | Authors: Xinchan Liu - Batf2 knockdown ameliorates early-stage hyperoxia-induced BPD-like lung injury and is associated with suppression of GBP5/NF-κB signaling.
Journal: Int Immunopharmacol | Authors: Shanshan Duan - Targeting Cathepsin B with p-coumaric acid rescues WWP1-dependent proteasomal degradation of NLRP3 in hyperuricemic nephropathy.
Journal: Mol Med | Authors: Fengqin Li - SOX9 attenuates osteoarthritis bNy regulating autophagy via the PI3K/Akt/mTOR pathway.
Journal: Int J Biol Macromol | Authors: Jun Qin | Species: rat | Application: IF, IHC - RVG-Functionalized Liposomal Mollugin: A Targeted Nanotherapy for Spinal Cord Injury.
Journal: Adv Healthc Mater | Authors: Quan Zhou - Spatiotemporal bilayer microneedle patch potentiates methotrexate therapy in psoriasis by breaking the hypoxia-ROS vicious cycle.
Journal: J Control Release | Authors: Yukun Wang | Species: mouse | Application: IHC - Structural Characterization of a Glucan from Zingiber officinale and Its Efficacy in Alleviating Ulcerative Colitis by Ameliorating Gut Microbiota Imbalance.
Journal: J Agric Food Chem | Authors: Qiqi Wang - Tip-retained hydrated silk fibroin microneedles for sustained local delivery of TNF-α antagonist in psoriasis treatment.
Journal: Int J Pharm X | Authors: Sai Gao | Species: mouse | Application: IF - Compositional analysis and physicochemical characterization of a purified tremella fuciformis polysaccharide-rich fraction and its intestinal barrier- and microbiota-related effects in DSS-induced colitis.
Journal: Food Res Int | Authors: Xinjiu Deng - Anion-Dependent Layered Double Hydroxide-Reinforced Gelatin Methacryloyl Hydrogels for Osteoimmunomodulation and Bone Regeneration.
Journal: Int J Nanomedicine | Authors: Zhong Wang | Species: mouse | Application: IF - Dysregulated JAK2 signaling delays fracture healing by enhancing STAT3/NF-κB signaling and inhibiting BMP2-mediated osteogenesis.
Journal: Life Sci | Authors: Cheng Zhang - Bardoxolone methyl exerts an inhibitory effect on respiratory syncytial virus infection by downregulating IL-6 via the IKKβ/NF-κB signaling pathway.
Journal: Microbiol Spectr | Authors: Xunping Wu | Species: mouse,human | Application: WB - Gaseous Air Pollutant Exposure and Atherosclerosis: A Systematic Study Integrating Multi-Omics and Network Toxicology.
Journal: Int J Mol Sci | Authors: Husileng Hai - Tectorigenin alleviates HFpEF by targeting the EGFR-EGR2-Acot1 axis to improve myocardial lipid metabolism.
Journal: Acta Pharmacol Sin | Authors: Li-guo Wang | Species: mouse | Application: WB - Tangeretin alleviates psoriasis through inhibition of the IL-23/IL-23R signaling pathway.
Journal: Int Immunopharmacol | Authors: Qing Liu | Species: mouse | Application: WB, IHC - Rose Bengal acetate-mediated photodynamic therapy alleviates Cutibacterium acnes-induced acne-like lesions in a mouse model.
Journal: J Photochem Photobiol B | Authors: Wanxin Zeng - The Impact of Overtraining on Anxiety-Like Behavior and Tight Junction Proteins of the Blood-Brain Barrier in Mice.
Journal: Brain Behav | Authors: Eunseon Hwang | Species: mouse | Application: WB - Glycoside fraction from pear seed functionally antagonizes sFLT-1 and restores angiogenic signaling in preeclampsia.
Journal: Hypertens Res | Authors: Peter U. Amadi - MYBL2 promotes malignant phenotypes and M2-like macrophage polarization through CCL2 in non-small cell lung cancer.
Journal: Mol Cell Biochem | Authors: Qiong Sun - TET2 deletion in the olfactory bulb aggravates olfactory impairment in mice with cigarette smoke-induced nasal polyps.
Journal: Int Immunopharmacol | Authors: Peiqiang Liu - A high-risk sepsis subtype identified by regulated cell death signatures and MAD2L2 validation.
Journal: Front Immunol | Authors: Lifang Luo - A Multifunctional Ginseng Polysaccharide Hydrogel Loaded With Rg3 Microspheres Enhances Wound Healing via Antioxidant, Antibacterial, and Microbiota-Modulating Effects.
Journal: Adv Healthc Mater | Authors: Hao Chen - Biomimetic nanodelivery of antagomiR-155-5p ameliorates wear particle-induced osteolysis by dual regulation of Gas6/Axl-mediated macrophage inflammation.
Journal: J Orthop Translat | Authors: Taihe Liu - β-carotene attenuates calcium oxalate crystal-induced renal injury through suppression of NF-κB-mediated inflammation.
Journal: Urolithiasis | Authors: Mingqin Su
Reviews
Write Your Own Review