SLC35A1 Monoclonal antibody, PBS Only (Detector) 68788-2-PBS proteintech
$699.00
In stock
SKU
68788-2-PBS
| Catalog Number | 68788-2-PBS |
| Synonyms | CMP SA Tr, CMP Sia Tr, CMP sialic acid transporter, CMPST, CST, hCST, inactive, SLC35A1 |
| Host | Mouse |
| Reactivity | Human |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA, Cytometric bead array |
| Host / Isotype | Mouse / IgG1 |
| Tested Reactivity | Human |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag9524 Product name: Recombinant human SLC35A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC017807 Sequence: MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTA Predict reactive species |
| Full Name | solute carrier family 35 (CMP-sialic acid transporter), member A1 |
| Calculated Molecular Weight | 337 aa, 37 kDa |
| GenBank Accession Number | BC017807 |
| Gene Symbol | SLC35A1 |
| Gene ID (NCBI) | 10559 |
| Conjugate | Unconjugated |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | P78382 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Clone Number | 1D5C8 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
