SLC35B3 Polyclonal antibody 31436-1-AP proteintech
$149.00
In stock
SKU
31436-1-AP
| Catalog Number | 31436-1-AP |
| Synonyms | PAPST2, PAPS transporter 2, CGI 19, C6orf196 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS, Azide, Glycerol |
| Applications | WB, ELISA |
| Host / Isotype | Rabbit / IgG |
| Tested Applications — Positive WB detected in | L02 cells, MCF-7 cells, MDA-MB-231 cells, U2OS cells, MG-63 cells |
| Recommended Dilutions — Western Blot (WB) | WB : 1:2000-1:12000 |
| Positive WB detected in | L02 cells, MCF-7 cells, MDA-MB-231 cells, U2OS cells, MG-63 cells |
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Tested Reactivity | human |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | CatNo: Ag34349 Product name: Recombinant human SLC35B3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC006973 Sequence: MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIKSVDDVVVLGMNLSKFNK Predict reactive species |
| Full Name | solute carrier family 35, member B3 |
| Calculated Molecular Weight | 401 aa, 45 kDa |
| Observed Molecular Weight | 40, 32 kDa |
| GenBank Accession Number | BC006973 |
| Gene Symbol | SLC35B3 |
| Gene ID (NCBI) | 51000 |
| RRID | AB_3742427 |
| Conjugate | Unconjugated |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9H1N7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. |
| WB protocol for SLC35B3 antibody 31436-1-AP | Download protocol |
| Citations | - |
| Dilutions | WB : 1:2000-1:12000 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Clone Number | - |
| Conjugation | Unconjugated |
SLC35B3 (solute carrier family 35 member B3) is a member of the solute carrier family. SLC35B3 is involved in transporting 3-prime phosphoadenosine 5-prime phosphosulfate (PAPS) from the nucleus or the cytosol to the Golgi lumen. The observed MW of SLC35B3 is 40 kDa and 32 kDa, which is due to alternative splicing. Protocols Product Specific Protocols WB protocol for SLC35B3 antibody 31436-1-AP Download protocol Standard Protocols Click here to view our Standard Protocols
Product Documents
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
