SLC35E4 Recombinant monoclonal antibody, PBS Only (Capture) 82999-2-PBS proteintech
$699.00
In stock
SKU
82999-2-PBS
| Catalog Number | 82999-2-PBS |
| Synonyms | SLC35E4 |
| Host | Rabbit |
| Reactivity | Human |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Indirect ELISA, Cytometric bead array |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | Human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag34360 Product name: Recombinant human SLC35E4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 156-217 aa of BC040191 Sequence: GRRHHPLQLAAMGPLCLGAACSLAGEFRTPPTGCGFLLAATCLRGLKSVQQSALLQEERLDA Predict reactive species |
| Full Name | solute carrier family 35, member E4 |
| Calculated Molecular Weight | 350 aa, 37 kDa |
| GenBank Accession Number | BC040191 |
| Gene Symbol | SLC35E4 |
| Gene ID (NCBI) | 339665 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6ICL7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 240089C12 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
