SLC38A2 Recombinant monoclonal antibody, PBS Only (Detector) 83968-3-PBS proteintech
$699.00
In stock
SKU
83968-3-PBS
| Catalog Number | 83968-3-PBS |
| Synonyms | Protein 40-9-1, Protein 40 9 1, PRO1068, KIAA1382, ATA2 |
| Host | Rabbit |
| Reactivity | human |
| Form | Liquid |
| Formulation | PBS Only |
| Applications | Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test |
| Host / Isotype | Rabbit / IgG |
| Tested Reactivity | human |
| Class | Recombinant |
| Type | Antibody |
| Immunogen | CatNo: Ag23082 Product name: Recombinant human SLC38A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC040342 Sequence: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQN Predict reactive species |
| Full Name | solute carrier family 38, member 2 |
| GenBank Accession Number | BC040342 |
| Gene Symbol | SLC38A2 |
| Gene ID (NCBI) | 54407 |
| Conjugate | Unconjugated |
| Purification Method | Protein A purification |
| UNIPROT ID | Q96QD8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
| Citations | - |
| Isotype | IgG |
| Clonality | Recombinant |
| Clone Number | 241059G3 |
| Conjugation | Unconjugated |
Reviews
Write Your Own Review
Related Products
Check items to add to the cart or
